close

SimulationCraft 815-02

for World of Warcraft 8.2.0 PTR (wow build level 30329)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-05-15 Real Procs Per Minute data removed from Killing Machine.
Killing Machine rppm 4.50 0.00
2019-03-12 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2018-05-02 Incorrect spell level for Icicle buff.
Icicles spell_level 78.00 80.00
2017-11-08 Incorrect spell level for Ignite.
Ignite spell_level 78.00 99.00
2017-11-06 Incorrect spell level for Icicle.
Icicle spell_level 78.00 80.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-01-07 Incorrect Maelstrom generation value for Chain Lightning Overloads.
Fulmination (effect#6) base_value 2.00 3.00

Table of Contents

Raid Summary

 

Created with Highcharts 4.2.3 Damage per Second45,782 (11.25%)44,235 (7.49%)42,810 (4.03%)42,739 (3.86%)42,735 (3.85%)42,099 (2.30%)41,924 (1.88%)41,814 (1.61%)41,152visionslucid dreamsfocusing irisblood of the enemyunbound forcepurification protocolworldveinripple in spacebasebase Damage per Second: 41,152.0

Actions per Minute / DPS Variance Summary

base : 41152 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
41152.1 41152.1 21.6 / 0.052% 5113.0 / 12.4% 4954.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.3 8.2 Astral Power 0.00% 58.5 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
base 41152
Heed My Call 303 (433) 0.7% (1.1%) 8.2 33.14sec 15756 0 Direct 8.2 9128 18244 11025 20.8%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.23 8.23 0.00 0.00 0.0000 0.0000 90699.08 90699.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.52 79.20% 9128.31 8921 9813 9127.87 0 9813 59475 59475 0.00
crit 1.71 20.80% 18243.58 17842 19626 15000.86 0 19626 31224 31224 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 130 0.3% 8.2 33.14sec 4732 0 Direct 8.2 3912 7820 4732 21.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.23 8.23 0.00 0.00 0.0000 0.0000 38927.35 38927.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.50 79.02% 3911.99 3823 4206 3911.41 0 4206 25433 25433 0.00
crit 1.73 20.98% 7819.82 7646 8411 6480.93 0 8411 13494 13494 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6014 14.6% 78.4 3.73sec 22972 17691 Direct 78.4 18971 38568 22972 20.4%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.39 78.39 0.00 0.00 1.2985 0.0000 1800687.10 1800687.10 0.00 17691.09 17691.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.38 79.58% 18970.81 10135 24211 18977.37 18154 19968 1183469 1183469 0.00
crit 16.00 20.42% 38567.93 20270 48422 38598.82 35153 44039 617218 617218 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2929 7.1% 14.1 21.42sec 62362 62186 Direct 14.1 3276 6654 3961 20.3%  
Periodic 223.9 3010 6145 3667 21.0% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.06 14.06 223.90 223.90 1.0028 1.3291 876695.17 876695.17 0.00 2812.72 62185.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.21 79.71% 3275.77 2981 4065 3277.16 2981 3651 36708 36708 0.00
crit 2.85 20.29% 6654.01 5963 8130 6397.73 0 8130 18980 18980 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 177.0 79.05% 3009.98 2 3785 3011.18 2928 3153 532737 532737 0.00
crit 46.9 20.95% 6145.32 17 7570 6149.31 5800 6717 288271 288271 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 939 2.3% 44.6 6.57sec 6301 0 Direct 44.6 5174 10565 6301 20.9%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.60 44.60 0.00 0.00 0.0000 0.0000 281038.50 281038.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.28 79.10% 5174.23 4769 6503 5176.25 4850 5619 182543 182543 0.00
crit 9.32 20.90% 10565.31 9539 13006 10572.03 0 13006 98496 98496 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3383 (5394) 8.2% (13.1%) 95.6 3.09sec 16892 18780 Direct 96.1 8652 17653 10540 21.0%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.59 96.09 0.00 0.00 0.8995 0.0000 1012756.61 1012756.61 0.00 18779.85 18779.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.93 79.03% 8651.74 7949 10838 8656.07 8356 9061 656967 656967 0.00
crit 20.15 20.97% 17653.00 15898 21676 17669.65 16299 19557 355790 355790 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2011 4.9% 75.4 3.89sec 7980 0 Direct 75.4 7980 0 7980 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.43 75.43 0.00 0.00 0.0000 0.0000 601934.48 601934.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.43 100.00% 7979.56 5962 16257 7986.30 6917 9544 601934 601934 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 14047 34.2% 62.1 4.88sec 67693 64810 Direct 61.9 55750 113788 67918 21.0%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.10 61.89 0.00 0.00 1.0445 0.0000 4203571.66 4203571.66 0.00 64809.92 64809.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.92 79.04% 55750.43 51347 69612 55768.17 53708 58461 2727170 2727170 0.00
crit 12.97 20.96% 113787.51 102695 139223 113906.03 102695 133731 1476402 1476402 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1902 4.6% 12.8 23.57sec 44522 43725 Direct 12.8 2779 5665 3367 20.3%  
Periodic 221.5 1951 3982 2376 21.0% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.79 12.79 221.49 221.49 1.0183 1.3321 569389.52 569389.52 0.00 1848.22 43725.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.19 79.65% 2779.46 2570 3504 2779.22 2570 3132 28314 28314 0.00
crit 2.60 20.35% 5664.56 5140 7009 5367.92 0 7009 14740 14740 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 175.1 79.04% 1950.57 1 2453 1951.35 1897 2044 341500 341500 0.00
crit 46.4 20.96% 3982.21 12 4906 3984.79 3742 4392 184836 184836 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6240 15.1% 90.9 3.08sec 20446 0 Direct 90.9 16390 32745 20446 24.8%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.86 90.86 0.00 0.00 0.0000 0.0000 1857803.83 1857803.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.33 75.20% 16389.69 16021 17623 16389.35 16021 17273 1119895 1119895 0.00
crit 22.53 24.80% 32745.09 32042 35246 32744.89 32042 34909 737909 737909 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3253 7.9% 17.8 16.87sec 54843 53917 Direct 17.8 4491 9069 5398 19.8%  
Periodic 223.1 3233 6596 3936 20.9% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.75 17.75 223.07 223.07 1.0172 1.3300 973743.20 973743.20 0.00 3093.77 53917.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.23 80.17% 4490.74 4112 5607 4490.90 4139 4879 63924 63924 0.00
crit 3.52 19.83% 9068.70 8225 11214 8884.47 0 11214 31926 31926 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 176.5 79.11% 3233.32 5 4065 3234.60 3131 3396 570607 570607 0.00
crit 46.6 20.89% 6595.72 22 8130 6600.17 6194 7144 307286 307286 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
base
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.70sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.53sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9032 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.3 54.6 43.7sec 4.9sec 93.19% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.93%
  • arcanic_pulsar_2:10.44%
  • arcanic_pulsar_3:11.16%
  • arcanic_pulsar_4:10.63%
  • arcanic_pulsar_5:13.68%
  • arcanic_pulsar_6:10.78%
  • arcanic_pulsar_7:10.76%
  • arcanic_pulsar_8:13.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.6sec 0.0sec 16.23% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:base
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.7sec 182.7sec 8.12% 7.50% 0.0(0.0) 2.0

Buff details

  • buff initial source:base
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:base
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.3 0.0 37.5sec 37.5sec 26.10% 32.63% 0.0(0.0) 8.1

Buff details

  • buff initial source:base
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.1 60.8sec 45.6sec 23.61% 0.00% 1.1(1.1) 4.1

Buff details

  • buff initial source:base
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.23% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:base
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.96%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.7 46.7 8.8sec 3.7sec 82.23% 99.73% 1.9(1.9) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.83%
  • lunar_empowerment_2:32.02%
  • lunar_empowerment_3:14.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 399.2(399.2) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.5 64.4sec 33.7sec 48.03% 0.00% 3.5(48.9) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.04%
  • overwhelming_power_16:2.10%
  • overwhelming_power_17:2.17%
  • overwhelming_power_18:2.23%
  • overwhelming_power_19:2.30%
  • overwhelming_power_20:2.37%
  • overwhelming_power_21:2.44%
  • overwhelming_power_22:2.52%
  • overwhelming_power_23:2.60%
  • overwhelming_power_24:2.67%
  • overwhelming_power_25:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 25.2 52.6 11.9sec 3.9sec 85.49% 78.62% 0.2(0.2) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.24%
  • solar_empowerment_2:39.82%
  • solar_empowerment_3:17.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.8 20.2sec 4.9sec 97.89% 92.86% 16.5(16.5) 11.4

Buff details

  • buff initial source:base
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:13.92%
  • starlord_2:22.51%
  • starlord_3:61.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.9sec 45.5sec 23.64% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:base
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.64%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
base
starsurge Astral Power 62.1 2483.9 40.0 40.0 1692.3
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 96.59 772.68 (31.59%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.27%) 40.00 0.00 0.00%
sunfire Astral Power 17.75 53.26 (2.18%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.60 178.40 (7.29%) 4.00 0.00 0.00%
moonfire Astral Power 14.06 42.17 (1.72%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.79 102.31 (4.18%) 8.00 0.00 0.00%
lunar_strike Astral Power 78.39 940.59 (38.45%) 12.00 0.06 0.01%
natures_balance Astral Power 400.21 200.11 (8.18%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.40 76.75 (3.14%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.16 8.29
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.26 0.00 67.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data base Fight Length
Count 14412
Mean 299.78
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data base Damage Per Second
Count 14412
Mean 41152.12
Minimum 36967.16
Maximum 46774.35
Spread ( max - min ) 9807.20
Range [ ( max - min ) / 2 * 100% ] 11.92%
Standard Deviation 1320.0126
5th Percentile 39084.01
95th Percentile 43443.45
( 95th Percentile - 5th Percentile ) 4359.44
Mean Distribution
Standard Deviation 10.9955
95.00% Confidence Intervall ( 41130.57 - 41173.67 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3953
0.1 Scale Factor Error with Delta=300 14875
0.05 Scale Factor Error with Delta=300 59498
0.01 Scale Factor Error with Delta=300 1487442
Priority Target DPS
Sample Data base Priority Target Damage Per Second
Count 14412
Mean 41152.12
Minimum 36967.16
Maximum 46774.35
Spread ( max - min ) 9807.20
Range [ ( max - min ) / 2 * 100% ] 11.92%
Standard Deviation 1320.0126
5th Percentile 39084.01
95th Percentile 43443.45
( 95th Percentile - 5th Percentile ) 4359.44
Mean Distribution
Standard Deviation 10.9955
95.00% Confidence Intervall ( 41130.57 - 41173.67 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3953
0.1 Scale Factor Error with Delta=300 14875
0.05 Scale Factor Error with Delta=300 59498
0.01 Scale Factor Error with Delta=300 1487442
DPS(e)
Sample Data base Damage Per Second (Effective)
Count 14412
Mean 41152.12
Minimum 36967.16
Maximum 46774.35
Spread ( max - min ) 9807.20
Range [ ( max - min ) / 2 * 100% ] 11.92%
Damage
Sample Data base Damage
Count 14412
Mean 12307246.51
Minimum 9497202.41
Maximum 15505901.27
Spread ( max - min ) 6008698.85
Range [ ( max - min ) / 2 * 100% ] 24.41%
DTPS
Sample Data base Damage Taken Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data base Healing Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data base Healing Per Second (Effective)
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data base Heal
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data base Healing Taken Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data base Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data baseTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data base Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 2.98 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 62.10 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 2.67 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 3.13 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 14.85 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
N 10.92 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.79 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 78.75 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 95.85 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.23 sunfire

Sample Sequence

0123456789ACDJNMOHFGJQJQPJQPQPJQPQMQNQPIJQJOQPJPPPQQQQJQJQJQPQKPNJPPJQOPJQPMPJQPQQPJNPJQPQJMOQPQJQPPQQJPJNQMPJQPOJQPPQQPJPJMNPQJQPQPQOQQIJQJQJGQKNPPJPPQQQPQQJJMOPPQJNQPJQPPQMQJPJQOQJQPLPJPQPMQPQJPJPQPHEFJOJNQMQPQPQIJQJQPJQPJQPQPJOKNPPQJPJQPQJPMQPJQNOPQJPQQGJPQMQJQPQJQPLQQOJPQJPMQQJPQQQJPQQNQJMOPQJPQQQJPQQQQQMJNJQPOKJPPQQJPQQQQJPJQP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask base 58.0/100: 58% astral_power
Pre precombat 1 food base 58.0/100: 58% astral_power
Pre precombat 2 augmentation base 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.238 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.163 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.088 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.014 default H celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.819 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.819 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.819 default J starsurge Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:05.575 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:06.330 default J starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.085 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:07.838 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.682 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.436 default Q solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.190 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.945 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.700 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.454 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.207 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(3)
0:13.962 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.715 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.467 default M sunfire Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.222 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.975 default N moonfire Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.729 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.483 default P lunar_strike Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.254 default I cancel_buff Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.254 default J starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.010 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.766 default J starsurge Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.522 default O stellar_flare Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.275 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.031 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(17), ignition_mages_fuse(5)
0:23.808 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(17), ignition_mages_fuse(5)
0:24.561 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(16), ignition_mages_fuse(5)
0:25.431 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(15)
0:26.487 default P lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(14)
0:27.545 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(13)
0:28.300 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(12)
0:29.055 default Q solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(11)
0:29.896 default Q solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(25)
0:30.696 default J starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(24)
0:31.500 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23)
0:32.255 default J starsurge Fluffy_Pillow 79.5/100: 80% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(22)
0:33.009 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(21)
0:33.763 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(21)
0:34.518 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20)
0:35.273 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(19)
0:36.180 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24)
0:36.937 default K sunfire Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(24)
0:37.690 default P lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(23)
0:38.716 default N moonfire Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22)
0:39.525 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), torrent_of_elements, overwhelming_power(21)
0:40.408 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(20)
0:41.507 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(19)
0:42.938 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(18)
0:44.064 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(16)
0:45.002 default O stellar_flare Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(15)
0:46.108 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(14)
0:47.524 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(13)
0:48.639 default Q solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(12)
0:49.563 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11)
0:50.954 default M sunfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10)
0:52.051 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8)
0:53.455 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(24)
0:54.498 default Q solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23)
0:55.387 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22)
0:56.725 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), overwhelming_power(21)
0:57.622 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(20)
0:58.520 default P lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(19)
0:59.871 default J starsurge Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(6), solar_empowerment, overwhelming_power(18)
1:01.031 default N moonfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(16)
1:02.166 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(15)
1:03.616 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord, overwhelming_power(14)
1:04.759 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(13)
1:05.708 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(12)
1:07.132 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(2), overwhelming_power(10)
1:08.090 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(9)
1:09.221 default M sunfire Fluffy_Pillow 16.0/100: 16% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(8)
1:10.182 default O stellar_flare Fluffy_Pillow 19.5/100: 20% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(7)
1:11.144 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(6)
1:11.967 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(6), conch_of_dark_whispers
1:13.200 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power celestial_alignment, solar_empowerment(3), starlord(3), overwhelming_power(4), conch_of_dark_whispers
1:14.028 default J starsurge Fluffy_Pillow 62.0/100: 62% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(3), conch_of_dark_whispers
1:15.005 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(2), conch_of_dark_whispers
1:15.966 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(2), conch_of_dark_whispers
1:17.403 default P lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:18.851 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:19.817 default Q solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar, solar_empowerment, starlord(3), conch_of_dark_whispers
1:20.784 default J starsurge Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar, conch_of_dark_whispers
1:22.023 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
1:23.555 default J starsurge Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers
1:24.758 default N moonfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers
1:25.926 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers
1:26.918 default M sunfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
1:28.089 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
1:29.578 default J starsurge Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
1:30.746 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:31.714 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers
1:33.038 default O stellar_flare Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
1:34.084 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
1:35.134 default Q solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
1:36.028 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers
1:37.377 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers
1:38.728 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(18)
1:39.633 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(17)
1:40.542 default P lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), overwhelming_power(16)
1:41.907 default J starsurge Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(5), overwhelming_power(15)
1:43.079 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13)
1:44.538 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(6), solar_empowerment, starlord, overwhelming_power(12)
1:45.689 default M sunfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(11)
1:46.810 default N moonfire Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(10)
1:47.937 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(9)
1:49.377 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(2), overwhelming_power(7)
1:50.344 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(6)
1:51.487 default Q solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(5), conch_of_dark_whispers
1:52.436 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4), conch_of_dark_whispers
1:53.863 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(3), conch_of_dark_whispers
1:54.819 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2), conch_of_dark_whispers
1:56.255 default Q solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:57.221 default O stellar_flare Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), conch_of_dark_whispers
1:58.356 default Q solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), conch_of_dark_whispers
1:59.323 default Q solar_wrath Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
2:00.460 default I cancel_buff Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
2:00.460 default J starsurge Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(8), conch_of_dark_whispers
2:01.698 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
2:02.588 default J starsurge Fluffy_Pillow 70.5/100: 71% astral_power celestial_alignment, lunar_empowerment, starlord, conch_of_dark_whispers
2:03.634 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers
2:04.498 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), conch_of_dark_whispers
2:05.514 default G use_items Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
2:05.514 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse
2:06.318 default K sunfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse
2:07.266 default N moonfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse
2:08.355 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse
2:09.740 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.072 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.116 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.447 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(2)
2:14.778 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(3)
2:15.632 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.636 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.639 default P lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(4)
2:18.871 default Q solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.838 default Q solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.807 default J starsurge Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar(3), lunar_empowerment, torrent_of_elements, ignition_mages_fuse(4)
2:21.859 default J starsurge Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, ignition_mages_fuse(5)
2:22.846 default M sunfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, ignition_mages_fuse(5)
2:23.803 default O stellar_flare Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, ignition_mages_fuse(5)
2:24.761 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, ignition_mages_fuse(5)
2:25.978 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
2:27.467 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements
2:28.462 default J starsurge Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
2:29.631 default N moonfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:30.768 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:31.735 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:33.182 default J starsurge Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:34.319 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:35.285 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:36.733 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:38.182 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:39.147 default M sunfire Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers
2:40.187 default Q solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers
2:41.073 default J starsurge Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(7), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
2:42.211 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
2:43.628 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
2:44.742 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(20), conch_of_dark_whispers
2:45.545 default O stellar_flare Fluffy_Pillow 29.5/100: 30% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(19), conch_of_dark_whispers
2:46.495 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(18), conch_of_dark_whispers
2:47.305 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(17), conch_of_dark_whispers
2:48.262 default Q solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), conch_of_dark_whispers
2:49.058 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(15), conch_of_dark_whispers
2:50.251 default L moonfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(14), conch_of_dark_whispers
2:51.190 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(13), conch_of_dark_whispers
2:52.571 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(12), conch_of_dark_whispers
2:53.659 default P lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers
2:55.049 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(9), conch_of_dark_whispers
2:55.984 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(9), conch_of_dark_whispers
2:57.384 default M sunfire Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(7), conch_of_dark_whispers
2:58.492 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(6), conch_of_dark_whispers
2:59.434 default P lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(5)
3:00.854 default Q solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(4)
3:01.805 default J starsurge Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(2), overwhelming_power(3)
3:03.031 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power
3:04.558 default J starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(3), solar_empowerment, starlord
3:05.760 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2)
3:07.250 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2)
3:08.244 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(2)
3:09.732 default H celestial_alignment Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(4), celestial_alignment, solar_empowerment, starlord(2)
3:10.749 default E potion Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(4), celestial_alignment, solar_empowerment, starlord(2)
3:10.749 default F berserking Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(4), celestial_alignment, solar_empowerment, starlord(2), battle_potion_of_intellect
3:10.749 default J starsurge Fluffy_Pillow 92.5/100: 93% astral_power berserking, arcanic_pulsar(4), celestial_alignment, solar_empowerment, starlord(2), battle_potion_of_intellect
3:11.673 default O stellar_flare Fluffy_Pillow 53.0/100: 53% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:12.571 default J starsurge Fluffy_Pillow 61.5/100: 62% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:13.471 default N moonfire Fluffy_Pillow 22.0/100: 22% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:14.371 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:15.135 default M sunfire Fluffy_Pillow 34.5/100: 35% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:16.035 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:16.799 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:17.942 default Q solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:18.707 default P lunar_strike Fluffy_Pillow 67.5/100: 68% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:19.852 default Q solar_wrath Fluffy_Pillow 80.5/100: 81% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:20.752 default I cancel_buff Fluffy_Pillow 93.0/100: 93% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:20.752 default J starsurge Fluffy_Pillow 93.0/100: 93% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, conch_of_dark_whispers, battle_potion_of_intellect
3:21.732 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:22.542 default J starsurge Fluffy_Pillow 66.5/100: 67% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:23.492 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:24.357 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:25.650 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:26.666 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(25), conch_of_dark_whispers, battle_potion_of_intellect
3:27.435 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect
3:28.590 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect
3:29.502 default Q solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22), battle_potion_of_intellect
3:30.278 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(21), battle_potion_of_intellect
3:31.445 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20), battle_potion_of_intellect
3:32.228 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(19), battle_potion_of_intellect
3:33.402 default J starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18), battle_potion_of_intellect
3:34.329 default O stellar_flare Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(17), battle_potion_of_intellect
3:35.258 default K sunfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), battle_potion_of_intellect
3:36.191 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15)
3:37.269 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14)
3:38.646 default P lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13)
3:40.026 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(11)
3:40.952 default J starsurge Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(2), solar_empowerment, torrent_of_elements, overwhelming_power(11)
3:42.141 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(9)
3:43.622 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(8)
3:44.790 default Q solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(7)
3:45.758 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(6)
3:47.212 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(4)
3:48.190 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(3)
3:49.345 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2)
3:50.783 default M sunfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power
3:51.916 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), torrent_of_elements
3:52.882 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
3:54.331 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements
3:55.468 default Q solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
3:56.435 default N moonfire Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
3:57.572 default O stellar_flare Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
3:58.709 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
4:00.156 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
4:01.122 default J starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(6), solar_empowerment
4:02.360 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord
4:03.891 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord
4:04.914 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord
4:05.936 default G use_items Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(7), solar_empowerment, starlord
4:05.936 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(7), solar_empowerment, starlord, ignition_mages_fuse
4:07.088 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse
4:08.514 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), ignition_mages_fuse
4:09.466 default M sunfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), ignition_mages_fuse
4:10.586 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), ignition_mages_fuse(2)
4:11.498 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), starlord(2), ignition_mages_fuse(2)
4:12.569 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), ignition_mages_fuse(2)
4:13.342 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power celestial_alignment, lunar_empowerment, starlord(3), ignition_mages_fuse(2)
4:14.497 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power celestial_alignment, starlord(3), ignition_mages_fuse(3)
4:15.370 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power celestial_alignment, starlord(3), ignition_mages_fuse(3)
4:16.243 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), ignition_mages_fuse(3)
4:16.996 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), ignition_mages_fuse(3)
4:18.108 default L moonfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar, celestial_alignment, starlord(3), ignition_mages_fuse(4)
4:18.948 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, starlord(3), ignition_mages_fuse(4)
4:19.917 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, starlord(3), ignition_mages_fuse(4)
4:20.882 default O stellar_flare Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, starlord(3), ignition_mages_fuse(4)
4:21.848 default J starsurge Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar, ignition_mages_fuse(4)
4:22.901 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, ignition_mages_fuse(5)
4:24.152 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(2), solar_empowerment, starlord, ignition_mages_fuse(5)
4:24.990 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), starlord, ignition_mages_fuse(5)
4:25.976 default P lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(2)
4:27.465 default M sunfire Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers
4:28.634 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers
4:29.628 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), conch_of_dark_whispers
4:30.621 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(3), starlord(2), conch_of_dark_whispers
4:31.789 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
4:33.236 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), conch_of_dark_whispers
4:34.201 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(4), starlord(3), conch_of_dark_whispers
4:35.336 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), starlord(3), conch_of_dark_whispers
4:36.472 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), starlord(3), conch_of_dark_whispers
4:37.608 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
4:39.055 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), conch_of_dark_whispers
4:40.022 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), starlord(3), conch_of_dark_whispers
4:41.159 default N moonfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), starlord(3)
4:42.294 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5)
4:43.533 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5)
4:44.773 default M sunfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord
4:45.977 default O stellar_flare Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord
4:47.178 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord
4:48.709 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), solar_empowerment, starlord
4:49.732 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), starlord
4:50.934 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2)
4:52.421 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2)
4:53.413 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(7), starlord(2), overwhelming_power(25)
4:54.481 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(7), starlord(2), overwhelming_power(24)
4:55.553 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(7), starlord(2), overwhelming_power(23)
4:56.629 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(22)
4:57.967 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(21)
4:58.863 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(20)
4:59.763 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(19)
5:00.824 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(18)
5:01.886 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(17)
5:02.954 default M sunfire Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(16)
5:04.027 default J starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(8), overwhelming_power(14)
5:05.203 default N moonfire Fluffy_Pillow 44.5/100: 45% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13)
5:06.201 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(12)
5:07.202 default Q solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(11)
5:08.032 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(10)
5:09.280 default O stellar_flare Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(9)
5:10.264 default K sunfire Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(8)
5:11.252 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(7)
5:12.390 default P lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(6)
5:13.805 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5), conch_of_dark_whispers
5:15.225 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(3), conch_of_dark_whispers
5:16.180 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(2), conch_of_dark_whispers
5:17.140 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power, conch_of_dark_whispers
5:18.273 default P lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
5:19.719 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), conch_of_dark_whispers
5:20.684 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), starlord(3), conch_of_dark_whispers
5:21.821 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(3), starlord(3), conch_of_dark_whispers
5:22.957 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), starlord(3), conch_of_dark_whispers
5:24.094 default J starsurge Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(3), conch_of_dark_whispers
5:25.332 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
5:26.863 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord, conch_of_dark_whispers
5:28.067 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), conch_of_dark_whispers
5:29.062 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="base"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

blood of the enemy : 42739 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
42739.2 42739.2 23.3 / 0.055% 5527.2 / 12.9% 5160.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.3 8.1 Astral Power 0.00% 59.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
blood of the enemy 42739
Blood of the Enemy 441 1.0% 3.7 91.14sec 35888 37558 Direct 3.7 27660 69236 35889 19.8%  

Stats details: blood_of_the_enemy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.68 3.68 0.00 0.00 0.9557 0.0000 132015.87 132015.87 0.00 37557.86 37557.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.95 80.21% 27660.24 27139 29853 27556.40 0 29853 81612 81612 0.00
crit 0.73 19.79% 69235.50 67847 74632 38512.34 0 74632 50404 50404 0.00
 
 

Action details: blood_of_the_enemy

Static Values
  • id:297108
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown.ca_inc.remains>30
Spelldata
  • id:297108
  • name:Blood of the Enemy
  • school:shadow
  • tooltip:You have a $w2% increased chance to be Critically Hit by the caster.
  • description:The Heart of Azeroth erupts violently, dealing {$s1=5936} Shadow damage to enemies within $A1 yds. You gain $m2% critical strike chance against the targets for {$d=10 seconds}$?a297122[, and increases your critical hit damage by $297126m% for {$297126d=5 seconds}][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24659.81
  • base_dd_max:24659.81
  • base_dd_mult:1.00
 
Heed My Call 316 (451) 0.7% (1.1%) 8.3 32.62sec 16252 0 Direct 8.3 9129 18752 11374 23.3%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.31 8.31 0.00 0.00 0.0000 0.0000 94553.89 94553.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.37 76.66% 9128.58 8921 9813 9128.82 8921 9813 58174 58174 0.00
crit 1.94 23.34% 18752.16 17842 24532 16250.80 0 24532 36380 36380 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 135 0.3% 8.3 32.62sec 4877 0 Direct 8.3 3913 8033 4877 23.4%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.31 8.31 0.00 0.00 0.0000 0.0000 40542.94 40542.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.37 76.59% 3912.86 3823 4206 3911.31 0 4206 24913 24913 0.00
crit 1.95 23.41% 8032.74 7646 10514 6955.06 0 10514 15630 15630 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6106 14.3% 78.0 3.74sec 23432 18218 Direct 78.0 18962 38931 23432 22.4%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.03 78.03 0.00 0.00 1.2862 0.0000 1828290.22 1828290.22 0.00 18217.68 18217.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.56 77.61% 18961.74 10135 24211 18968.67 18120 19979 1148292 1148292 0.00
crit 17.47 22.39% 38930.65 20270 60528 38963.19 34754 45401 679999 679999 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3047 7.1% 14.0 21.44sec 64912 65068 Direct 14.0 3274 6788 4068 22.6%  
Periodic 226.2 3009 6321 3779 23.2% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.05 14.05 226.19 226.19 0.9977 1.3157 911791.55 911791.55 0.00 2926.00 65067.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.88 77.43% 3274.36 2981 4065 3275.69 2981 3595 35611 35611 0.00
crit 3.17 22.57% 6788.38 5963 10163 6624.98 0 10163 21525 21525 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.6 76.76% 3008.64 2 3785 3009.85 2920 3161 522349 522349 0.00
crit 52.6 23.24% 6320.80 8 9462 6326.17 5825 6990 332306 332306 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 978 2.3% 45.1 6.49sec 6493 0 Direct 45.1 5172 10856 6493 23.2%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.09 45.09 0.00 0.00 0.0000 0.0000 292727.39 292727.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.61 76.76% 5171.80 4769 6503 5173.52 4884 5655 178988 178988 0.00
crit 10.48 23.24% 10855.73 9539 16257 10863.81 9539 14779 113739 113739 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3432 (5476) 8.0% (12.8%) 95.0 3.10sec 17249 19328 Direct 95.5 8642 17818 10751 23.0%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.03 95.54 0.00 0.00 0.8924 0.0000 1027166.82 1027166.82 0.00 19328.25 19328.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.58 77.02% 8641.72 7949 10838 8645.93 8363 9117 635892 635892 0.00
crit 21.96 22.98% 17818.25 15898 27096 17836.17 16142 19863 391274 391274 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2045 4.8% 75.1 3.90sec 8152 0 Direct 75.1 8152 0 8152 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.08 75.08 0.00 0.00 0.0000 0.0000 612062.08 612062.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.08 100.00% 8152.46 5962 20322 8159.19 6950 9751 612062 612062 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 14486 33.9% 61.9 4.88sec 69994 67615 Direct 61.7 55688 117664 70225 23.5%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.92 61.72 0.00 0.00 1.0352 0.0000 4333931.34 4333931.34 0.00 67615.20 67615.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.24 76.55% 55687.61 51347 69612 55706.00 53526 58664 2630777 2630777 0.00
crit 14.47 23.45% 117664.44 102695 174029 117853.94 102695 143424 1703154 1703154 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1982 4.6% 12.8 23.57sec 46369 45814 Direct 12.8 2776 5887 3479 22.6%  
Periodic 223.9 1950 4098 2450 23.3% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.79 12.79 223.91 223.91 1.0122 1.3177 593105.41 593105.41 0.00 1925.69 45813.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.90 77.40% 2775.83 2570 3504 2775.40 2570 3086 27480 27480 0.00
crit 2.89 22.60% 5886.71 5140 8761 5675.87 0 8761 17020 17020 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 171.8 76.73% 1950.25 1 2453 1951.03 1902 2041 335056 335056 0.00
crit 52.1 23.27% 4098.10 13 6133 4101.67 3796 4521 213550 213550 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6391 14.9% 89.9 3.11sec 21169 0 Direct 89.9 16391 34155 21169 26.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.87 89.87 0.00 0.00 0.0000 0.0000 1902504.43 1902504.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.70 73.10% 16390.79 16021 17623 16390.67 16021 17317 1076851 1076851 0.00
crit 24.17 26.90% 34154.57 32042 44057 34166.37 32042 38159 825653 825653 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3382 7.9% 17.8 16.77sec 56711 56170 Direct 17.8 4485 9284 5557 22.3%  
Periodic 225.3 3232 6774 4052 23.1% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.85 17.85 225.34 225.34 1.0097 1.3168 1012133.93 1012133.93 0.00 3215.80 56170.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.86 77.68% 4485.43 4112 5607 4485.48 4148 4887 62182 62182 0.00
crit 3.98 22.32% 9284.34 8225 14018 9177.40 0 14018 36990 36990 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.2 76.87% 3232.28 2 4065 3233.55 3133 3392 559885 559885 0.00
crit 52.1 23.13% 6774.19 8 10163 6780.17 6300 7403 353078 353078 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
blood of the enemy
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.69sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.57sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8986 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.3 54.4 43.8sec 4.9sec 93.25% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.85%
  • arcanic_pulsar_2:10.27%
  • arcanic_pulsar_3:11.53%
  • arcanic_pulsar_4:10.89%
  • arcanic_pulsar_5:13.51%
  • arcanic_pulsar_6:10.53%
  • arcanic_pulsar_7:10.68%
  • arcanic_pulsar_8:13.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.6sec 0.0sec 16.23% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.7sec 182.7sec 8.12% 7.70% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blood-Soaked 5.5 0.0 54.9sec 54.9sec 14.47% 0.00% 0.0(0.0) 5.4

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodsoaked
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:631.87

Stack Uptimes

  • bloodsoaked_1:14.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297168
  • name:Blood-Soaked
  • tooltip:Haste increased by $w1. While active Blood of the Enemy stacks are not granted.
  • description:{$@spelldesc297147=Your critical strikes with spells and abilities grant a stack of Blood-Soaked$?a297177[, increasing Critical Strike by {$297147s3=0}][]. Upon reaching {$297162u=40} stacks, you gain {$s2=0} Haste for {$297168d=8 seconds}.$?a297178[ Blood-Soaked has a {$297178s1=25}% chance of only consuming {$297178s2=30} stacks.][]}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Blood-Soaked (_counter) 5.0 218.2 63.1sec 1.3sec 86.67% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodsoaked_counter
  • max_stacks:40
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:9.69

Stack Uptimes

  • bloodsoaked_counter_1:2.51%
  • bloodsoaked_counter_2:2.30%
  • bloodsoaked_counter_3:2.14%
  • bloodsoaked_counter_4:2.02%
  • bloodsoaked_counter_5:1.96%
  • bloodsoaked_counter_6:1.95%
  • bloodsoaked_counter_7:1.91%
  • bloodsoaked_counter_8:1.90%
  • bloodsoaked_counter_9:1.87%
  • bloodsoaked_counter_10:6.06%
  • bloodsoaked_counter_11:2.42%
  • bloodsoaked_counter_12:2.43%
  • bloodsoaked_counter_13:2.41%
  • bloodsoaked_counter_14:2.38%
  • bloodsoaked_counter_15:2.35%
  • bloodsoaked_counter_16:2.32%
  • bloodsoaked_counter_17:2.30%
  • bloodsoaked_counter_18:2.29%
  • bloodsoaked_counter_19:2.25%
  • bloodsoaked_counter_20:2.22%
  • bloodsoaked_counter_21:2.20%
  • bloodsoaked_counter_22:2.17%
  • bloodsoaked_counter_23:2.16%
  • bloodsoaked_counter_24:2.13%
  • bloodsoaked_counter_25:2.11%
  • bloodsoaked_counter_26:2.09%
  • bloodsoaked_counter_27:2.09%
  • bloodsoaked_counter_28:2.08%
  • bloodsoaked_counter_29:2.05%
  • bloodsoaked_counter_30:2.04%
  • bloodsoaked_counter_31:2.02%
  • bloodsoaked_counter_32:2.00%
  • bloodsoaked_counter_33:1.98%
  • bloodsoaked_counter_34:1.97%
  • bloodsoaked_counter_35:1.95%
  • bloodsoaked_counter_36:1.93%
  • bloodsoaked_counter_37:1.92%
  • bloodsoaked_counter_38:1.90%
  • bloodsoaked_counter_39:1.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297162
  • name:Blood-Soaked
  • tooltip:$?a297177[Critical strike increased by $w2. ][]$@spellaura297147
  • description:{$@spelldesc297147=Your critical strikes with spells and abilities grant a stack of Blood-Soaked$?a297177[, increasing Critical Strike by {$297147s3=0}][]. Upon reaching {$297162u=40} stacks, you gain {$s2=0} Haste for {$297168d=8 seconds}.$?a297178[ Blood-Soaked has a {$297178s1=25}% chance of only consuming {$297178s2=30} stacks.][]}
  • max_stacks:40
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.3 0.0 37.4sec 37.4sec 26.06% 32.50% 0.0(0.0) 8.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.1sec 45.3sec 23.68% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.24% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.96%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.4 46.7 8.8sec 3.7sec 82.10% 99.79% 1.9(1.9) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.76%
  • lunar_empowerment_2:32.04%
  • lunar_empowerment_3:14.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 399.2(399.2) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.6 64.1sec 33.5sec 48.46% 0.00% 3.6(49.5) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.55%
  • overwhelming_power_6:1.59%
  • overwhelming_power_7:1.64%
  • overwhelming_power_8:1.68%
  • overwhelming_power_9:1.73%
  • overwhelming_power_10:1.78%
  • overwhelming_power_11:1.83%
  • overwhelming_power_12:1.89%
  • overwhelming_power_13:1.94%
  • overwhelming_power_14:2.00%
  • overwhelming_power_15:2.06%
  • overwhelming_power_16:2.12%
  • overwhelming_power_17:2.19%
  • overwhelming_power_18:2.26%
  • overwhelming_power_19:2.32%
  • overwhelming_power_20:2.40%
  • overwhelming_power_21:2.47%
  • overwhelming_power_22:2.55%
  • overwhelming_power_23:2.63%
  • overwhelming_power_24:2.70%
  • overwhelming_power_25:1.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Seething Rage 3.7 0.0 91.1sec 91.1sec 6.11% 0.00% 0.0(0.0) 3.6

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_seething_rage
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • seething_rage_1:6.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297126
  • name:Seething Rage
  • tooltip:Critical strike damage increased by $w1%.
  • description:{$@spelldesc297122=Increases your critical hit damage by $297126m% for {$297126d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Solar Empowerment 24.8 52.7 12.0sec 3.9sec 85.88% 78.70% 0.3(0.3) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.23%
  • solar_empowerment_2:39.99%
  • solar_empowerment_3:17.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.6 20.2sec 4.9sec 97.81% 93.07% 16.4(16.4) 11.4

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.36%
  • starlord_2:22.49%
  • starlord_3:60.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 61.2sec 45.9sec 23.60% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.60%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
blood of the enemy
starsurge Astral Power 61.9 2476.7 40.0 40.0 1749.9
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 96.03 768.22 (31.49%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.28%) 40.00 0.00 0.00%
sunfire Astral Power 17.85 53.54 (2.19%) 3.00 0.00 0.00%
shooting_stars Astral Power 45.08 180.32 (7.39%) 4.00 0.01 0.01%
moonfire Astral Power 14.05 42.14 (1.73%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.79 102.33 (4.19%) 8.00 0.00 0.00%
lunar_strike Astral Power 78.03 936.25 (38.38%) 12.00 0.06 0.01%
natures_balance Astral Power 400.21 200.10 (8.20%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.37 76.46 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.14 8.26
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.97 0.00 68.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data blood of the enemy Fight Length
Count 14412
Mean 299.78
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data blood of the enemy Damage Per Second
Count 14412
Mean 42739.25
Minimum 38206.36
Maximum 48121.61
Spread ( max - min ) 9915.26
Range [ ( max - min ) / 2 * 100% ] 11.60%
Standard Deviation 1429.3242
5th Percentile 40463.22
95th Percentile 45155.35
( 95th Percentile - 5th Percentile ) 4692.13
Mean Distribution
Standard Deviation 11.9061
95.00% Confidence Intervall ( 42715.91 - 42762.58 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4297
0.1 Scale Factor Error with Delta=300 17440
0.05 Scale Factor Error with Delta=300 69760
0.01 Scale Factor Error with Delta=300 1743995
Priority Target DPS
Sample Data blood of the enemy Priority Target Damage Per Second
Count 14412
Mean 42739.25
Minimum 38206.36
Maximum 48121.61
Spread ( max - min ) 9915.26
Range [ ( max - min ) / 2 * 100% ] 11.60%
Standard Deviation 1429.3242
5th Percentile 40463.22
95th Percentile 45155.35
( 95th Percentile - 5th Percentile ) 4692.13
Mean Distribution
Standard Deviation 11.9061
95.00% Confidence Intervall ( 42715.91 - 42762.58 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4297
0.1 Scale Factor Error with Delta=300 17440
0.05 Scale Factor Error with Delta=300 69760
0.01 Scale Factor Error with Delta=300 1743995
DPS(e)
Sample Data blood of the enemy Damage Per Second (Effective)
Count 14412
Mean 42739.25
Minimum 38206.36
Maximum 48121.61
Spread ( max - min ) 9915.26
Range [ ( max - min ) / 2 * 100% ] 11.60%
Damage
Sample Data blood of the enemy Damage
Count 14412
Mean 12780825.86
Minimum 9741133.45
Maximum 16135587.62
Spread ( max - min ) 6394454.17
Range [ ( max - min ) / 2 * 100% ] 25.02%
DTPS
Sample Data blood of the enemy Damage Taken Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data blood of the enemy Healing Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data blood of the enemy Healing Per Second (Effective)
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data blood of the enemy Heal
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data blood of the enemy Healing Taken Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data blood of the enemy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data blood of the enemyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data blood of the enemy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
H 3.68 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.96 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.92 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.81 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 3.08 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.76 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 10.96 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.79 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 78.38 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 95.29 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.28 sunfire

Sample Sequence

0123456789ACDKONPIFGHKRQKRQKRQRKRNRQORQRQKPRLQKQQKRQQRRRKRKRQRQRJKKNOQPQKRQRQKRQQNKORKRQQPKRQRRRRNRRKRKRKRQKOQQQKHNPQRRKQRORKQRRKQNQRPRRKQKGRQKRQMRKNQRRRRQRRKKPQRQKNORQKRQQRRRKKPQNQKRQRKRQORRQRRKIEFHKNRKPRQKORQKRQRQRQKKNQQQKRPRKRQMQQRNKQKQRQKQRRRKOPNQRKGQRRKQRRRKQRRNRORPRRJKRKRKRQLQKQHQRQRORRKKPQNRQRKRQKRQQRORKQKNPKRQLRKRQRQQRRRKKQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask blood of the enemy 58.0/100: 58% astral_power
Pre precombat 1 food blood of the enemy 58.0/100: 58% astral_power
Pre precombat 2 augmentation blood of the enemy 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power lunar_empowerment, battle_potion_of_intellect
0:01.238 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:02.163 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter, battle_potion_of_intellect
0:03.089 default P stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter(2), battle_potion_of_intellect
0:04.015 default I celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter(2), battle_potion_of_intellect
0:04.820 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter(2), battle_potion_of_intellect
0:04.820 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter(2), battle_potion_of_intellect
0:04.820 default H blood_of_the_enemy Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter(2), battle_potion_of_intellect, ignition_mages_fuse
0:05.575 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter(4), battle_potion_of_intellect, ignition_mages_fuse
0:06.328 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), bloodsoaked_counter(6), battle_potion_of_intellect, ignition_mages_fuse
0:07.081 default Q lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), bloodsoaked_counter(9), battle_potion_of_intellect, ignition_mages_fuse
0:07.948 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), bloodsoaked_counter(11), battle_potion_of_intellect, ignition_mages_fuse
0:08.703 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(14), battle_potion_of_intellect, ignition_mages_fuse
0:09.457 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked_counter(17), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.267 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(20), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.023 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(20), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.778 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked_counter(21), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.586 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(22), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.341 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), bloodsoaked_counter(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.096 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked_counter(26), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.849 default N sunfire Fluffy_Pillow 9.5/100: 10% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), bloodsoaked_counter(29), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.604 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), bloodsoaked_counter(30), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.358 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), bloodsoaked_counter(32), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.136 default O moonfire Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(34), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.890 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(35), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.645 default Q lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), bloodsoaked_counter(38), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.468 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), bloodsoaked_counter(39), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.224 default Q lunar_strike Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.066 default K starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.819 default P stellar_flare Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.575 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.330 default L sunfire Fluffy_Pillow 73.5/100: 74% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, bloodsoaked, ignition_mages_fuse(5)
0:24.086 default Q lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, arcanic_pulsar(6), lunar_empowerment(3), starlord, bloodsoaked, ignition_mages_fuse(5)
0:24.995 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(25), bloodsoaked
0:25.785 default Q lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(24), bloodsoaked
0:26.768 default Q lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23), bloodsoaked
0:27.752 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22), bloodsoaked_counter
0:28.583 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(21), bloodsoaked_counter
0:29.338 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20), bloodsoaked_counter
0:30.374 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19), bloodsoaked_counter(2)
0:31.414 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(18), bloodsoaked_counter(3)
0:32.169 default R solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(17), bloodsoaked_counter(4)
0:32.924 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(17), bloodsoaked_counter(5)
0:33.747 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(16), bloodsoaked_counter(6)
0:34.571 default R solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(15), bloodsoaked_counter(6)
0:35.326 default K starsurge Fluffy_Pillow 80.5/100: 81% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(14), bloodsoaked_counter(6)
0:36.080 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(13), bloodsoaked_counter(9)
0:36.834 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(13), bloodsoaked_counter(9)
0:37.759 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(12), bloodsoaked_counter(9)
0:38.514 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(11), bloodsoaked_counter(9)
0:39.445 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3), overwhelming_power(10), bloodsoaked_counter(10)
0:40.199 default J cancel_buff Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(9), bloodsoaked_counter(11)
0:40.199 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, overwhelming_power(9), bloodsoaked_counter(11)
0:41.002 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(8), bloodsoaked_counter(12)
0:42.170 default N sunfire Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(7), bloodsoaked_counter(13)
0:43.308 default O moonfire Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(6), bloodsoaked_counter(13)
0:44.450 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(5), bloodsoaked_counter(14)
0:45.910 default P stellar_flare Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(4), bloodsoaked_counter(15)
0:47.061 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(2), bloodsoaked_counter(15)
0:48.538 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power, bloodsoaked_counter(16)
0:49.705 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(17)
0:50.670 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(17)
0:52.119 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(17)
0:53.084 default Q lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(17)
0:54.532 default K starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(17)
0:55.668 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(17)
0:56.634 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(17)
0:58.081 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(19)
0:59.528 default N sunfire Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), bloodsoaked_counter(19)
1:00.666 default K starsurge Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(5), solar_empowerment(2), bloodsoaked_counter(20)
1:01.903 default O moonfire Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord, bloodsoaked_counter(22)
1:03.104 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord, bloodsoaked_counter(22)
1:04.129 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, bloodsoaked_counter(23)
1:05.333 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), bloodsoaked_counter(24)
1:06.327 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(25), bloodsoaked_counter(26)
1:07.690 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24), bloodsoaked_counter(28)
1:09.055 default P stellar_flare Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(22), bloodsoaked_counter(29)
1:10.135 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(21), bloodsoaked_counter(30)
1:11.218 default R solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(20), bloodsoaked_counter(31)
1:12.118 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19), bloodsoaked_counter(32)
1:13.468 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(18), bloodsoaked_counter(33)
1:14.373 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(17), bloodsoaked_counter(33)
1:15.283 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(16), bloodsoaked_counter(33)
1:16.356 default R solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(15), bloodsoaked_counter(33)
1:17.434 default N sunfire Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(14), bloodsoaked_counter(34)
1:18.513 default R solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(13), bloodsoaked_counter(35)
1:19.597 default R solar_wrath Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(12), bloodsoaked_counter(35)
1:20.683 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(8), overwhelming_power(11), bloodsoaked_counter(36)
1:21.874 default R solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(10), bloodsoaked_counter(38)
1:22.733 default K starsurge Fluffy_Pillow 79.0/100: 79% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(9), bloodsoaked_counter(39)
1:23.745 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(8), bloodsoaked
1:24.524 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(7), bloodsoaked
1:25.448 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(6), bloodsoaked
1:26.214 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(5), bloodsoaked
1:27.364 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(4), bloodsoaked
1:28.406 default O moonfire Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(3), bloodsoaked
1:29.451 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(2), bloodsoaked
1:30.787 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power, bloodsoaked
1:32.128 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3)
1:33.576 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(25), bloodsoaked_counter
1:34.614 default H blood_of_the_enemy Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), bloodsoaked_counter
1:35.861 default N sunfire Fluffy_Pillow 6.5/100: 7% astral_power seething_rage, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), bloodsoaked_counter
1:36.908 default P stellar_flare Fluffy_Pillow 10.5/100: 11% astral_power seething_rage, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), bloodsoaked_counter
1:37.959 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power seething_rage, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), bloodsoaked_counter(3)
1:39.300 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power seething_rage, arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(19), bloodsoaked_counter(3)
1:40.204 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(18), bloodsoaked_counter(3)
1:41.110 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(4), torrent_of_elements, overwhelming_power(17), bloodsoaked_counter(3)
1:42.274 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(16), bloodsoaked_counter(3)
1:43.718 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(15), bloodsoaked_counter(3)
1:44.685 default O moonfire Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), starlord, torrent_of_elements, overwhelming_power(14), bloodsoaked_counter(4)
1:45.827 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), starlord, torrent_of_elements, overwhelming_power(13), bloodsoaked_counter(5)
1:46.974 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(5), starlord, torrent_of_elements, overwhelming_power(12), bloodsoaked_counter(6)
1:48.124 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(10), bloodsoaked_counter(6)
1:49.559 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(9), bloodsoaked_counter(6)
1:50.520 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), starlord(2), torrent_of_elements, overwhelming_power(8), bloodsoaked_counter(6)
1:51.655 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(7), bloodsoaked_counter(6)
1:52.794 default Q lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(6), bloodsoaked_counter(6)
1:54.210 default N sunfire Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(4), bloodsoaked_counter(7)
1:55.328 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(3), bloodsoaked_counter(7)
1:56.760 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(2), bloodsoaked_counter(7)
1:57.720 default P stellar_flare Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power, bloodsoaked_counter(8)
1:58.854 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(7), starlord(3), bloodsoaked_counter(8)
1:59.991 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(7), starlord(3), bloodsoaked_counter(9)
2:01.127 default K starsurge Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(7), bloodsoaked_counter(10)
2:02.365 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(10)
2:03.896 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(8), solar_empowerment, starlord, bloodsoaked_counter(12)
2:05.100 default G use_items Fluffy_Pillow 19.0/100: 19% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(13)
2:05.100 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(13), ignition_mages_fuse
2:05.927 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), bloodsoaked_counter(15), ignition_mages_fuse
2:07.166 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power celestial_alignment, solar_empowerment(2), starlord(2), bloodsoaked_counter(16), ignition_mages_fuse
2:08.140 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(17), ignition_mages_fuse
2:08.945 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(18), ignition_mages_fuse
2:10.150 default M moonfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), bloodsoaked_counter(19), ignition_mages_fuse(2)
2:11.057 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), bloodsoaked_counter(19), ignition_mages_fuse(2)
2:11.944 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, solar_empowerment, starlord(3), bloodsoaked_counter(19), ignition_mages_fuse(2)
2:12.989 default N sunfire Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(19), ignition_mages_fuse(2)
2:14.031 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(19), ignition_mages_fuse(3)
2:15.309 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(21), ignition_mages_fuse(3)
2:16.162 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), bloodsoaked_counter(21), ignition_mages_fuse(3)
2:17.014 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(2), starlord(3), bloodsoaked_counter(21), ignition_mages_fuse(3)
2:18.017 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(2), starlord(3), bloodsoaked_counter(21), ignition_mages_fuse(4)
2:18.982 default Q lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), bloodsoaked_counter(21), ignition_mages_fuse(4)
2:20.214 default R solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), bloodsoaked_counter(21), ignition_mages_fuse(4)
2:21.035 default R solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), bloodsoaked_counter(21), ignition_mages_fuse(4)
2:22.001 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar(2), lunar_empowerment, bloodsoaked_counter(22), ignition_mages_fuse(5)
2:23.016 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter(23), ignition_mages_fuse(5)
2:24.001 default P stellar_flare Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2), bloodsoaked_counter(23), ignition_mages_fuse(5)
2:24.957 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2), bloodsoaked_counter(23), ignition_mages_fuse(5)
2:26.178 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), bloodsoaked_counter(23)
2:27.172 default Q lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(23)
2:28.661 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(25)
2:29.829 default N sunfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(25), conch_of_dark_whispers
2:30.965 default O moonfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(27), conch_of_dark_whispers
2:32.102 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(27), conch_of_dark_whispers
2:33.068 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(27), conch_of_dark_whispers
2:34.516 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(28), conch_of_dark_whispers
2:35.654 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(28), conch_of_dark_whispers
2:36.620 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(28), conch_of_dark_whispers
2:38.067 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(28), conch_of_dark_whispers
2:39.515 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), bloodsoaked_counter(28), conch_of_dark_whispers
2:40.481 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), bloodsoaked_counter(29), conch_of_dark_whispers
2:41.450 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), bloodsoaked_counter(30), conch_of_dark_whispers
2:42.417 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(6), bloodsoaked_counter(30), conch_of_dark_whispers
2:43.658 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(31), conch_of_dark_whispers
2:44.859 default P stellar_flare Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(32), conch_of_dark_whispers
2:46.026 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(34), conch_of_dark_whispers
2:47.514 default N sunfire Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(35), conch_of_dark_whispers
2:48.682 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(37), conch_of_dark_whispers
2:50.170 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), bloodsoaked_counter(37), conch_of_dark_whispers
2:51.338 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(38), conch_of_dark_whispers
2:52.179 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(39), conch_of_dark_whispers
2:53.437 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power celestial_alignment, solar_empowerment(2), starlord(3), bloodsoaked, conch_of_dark_whispers
2:54.217 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power celestial_alignment, solar_empowerment, starlord(3), bloodsoaked, conch_of_dark_whispers
2:55.133 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), bloodsoaked, conch_of_dark_whispers
2:55.888 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24), bloodsoaked
2:56.969 default O moonfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(23), bloodsoaked
2:57.947 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(22), bloodsoaked
2:58.782 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, starlord(3), overwhelming_power(21), bloodsoaked
2:59.767 default Q lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(20), bloodsoaked
3:01.022 default R solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar, starlord(3), overwhelming_power(18), bloodsoaked
3:02.016 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar, starlord(3), overwhelming_power(17)
3:03.086 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar, overwhelming_power(16)
3:04.256 default I celestial_alignment Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(15), bloodsoaked_counter(3)
3:05.247 default E potion Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14), bloodsoaked_counter(3)
3:05.247 default F berserking Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14), bloodsoaked_counter(3), battle_potion_of_intellect
3:05.247 default H blood_of_the_enemy Fluffy_Pillow 93.0/100: 93% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14), bloodsoaked_counter(3), battle_potion_of_intellect
3:06.150 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power berserking, seething_rage, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13), bloodsoaked_counter(3), battle_potion_of_intellect
3:07.059 default N sunfire Fluffy_Pillow 58.5/100: 59% astral_power berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(12), bloodsoaked_counter(4), battle_potion_of_intellect
3:07.944 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(12), bloodsoaked_counter(6), battle_potion_of_intellect
3:08.700 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(11), bloodsoaked_counter(7), battle_potion_of_intellect
3:09.588 default P stellar_flare Fluffy_Pillow 31.0/100: 31% astral_power berserking, seething_rage, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(10), bloodsoaked_counter(9), battle_potion_of_intellect
3:10.456 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(9), bloodsoaked_counter(10), battle_potion_of_intellect
3:11.211 default Q lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(8), bloodsoaked_counter(12), battle_potion_of_intellect
3:12.324 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(7), bloodsoaked_counter(14), conch_of_dark_whispers, battle_potion_of_intellect
3:13.201 default O moonfire Fluffy_Pillow 21.5/100: 22% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(6), bloodsoaked_counter(14), conch_of_dark_whispers, battle_potion_of_intellect
3:14.081 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(5), bloodsoaked_counter(18), conch_of_dark_whispers, battle_potion_of_intellect
3:14.836 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(5), bloodsoaked_counter(20), conch_of_dark_whispers, battle_potion_of_intellect
3:15.961 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(4), bloodsoaked_counter(22), conch_of_dark_whispers, battle_potion_of_intellect
3:16.848 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(3), bloodsoaked_counter(24), conch_of_dark_whispers, battle_potion_of_intellect
3:17.605 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(2), bloodsoaked_counter(26), conch_of_dark_whispers, battle_potion_of_intellect
3:18.857 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power, bloodsoaked_counter(28), conch_of_dark_whispers, battle_potion_of_intellect
3:19.695 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), bloodsoaked_counter(29), conch_of_dark_whispers, battle_potion_of_intellect
3:20.955 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), bloodsoaked_counter(30), conch_of_dark_whispers, battle_potion_of_intellect
3:21.942 default Q lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), bloodsoaked_counter(31), conch_of_dark_whispers, battle_potion_of_intellect
3:23.202 default K starsurge Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, bloodsoaked_counter(32), conch_of_dark_whispers, battle_potion_of_intellect
3:24.280 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter(34), conch_of_dark_whispers, battle_potion_of_intellect
3:25.481 default N sunfire Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(2), bloodsoaked_counter(36), conch_of_dark_whispers, battle_potion_of_intellect
3:26.649 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(2), bloodsoaked_counter(37), conch_of_dark_whispers, battle_potion_of_intellect
3:28.137 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(37), battle_potion_of_intellect
3:29.624 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(39), battle_potion_of_intellect
3:31.112 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), bloodsoaked_counter(10), bloodsoaked
3:32.197 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(10), bloodsoaked
3:32.976 default P stellar_flare Fluffy_Pillow 24.5/100: 25% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(10), bloodsoaked
3:33.894 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(10), bloodsoaked
3:34.677 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(10), bloodsoaked
3:35.594 default R solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(10), bloodsoaked
3:36.374 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked_counter(10), bloodsoaked
3:37.543 default M moonfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(10), bloodsoaked
3:38.463 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(10), bloodsoaked
3:39.810 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(10)
3:41.256 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, solar_empowerment, starlord(3), bloodsoaked_counter(11)
3:42.223 default N sunfire Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar, starlord(3), bloodsoaked_counter(12)
3:43.360 default K starsurge Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar, bloodsoaked_counter(14)
3:44.600 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(14)
3:46.132 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(2), solar_empowerment, starlord, bloodsoaked_counter(17)
3:47.334 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(19)
3:48.821 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), bloodsoaked_counter(20)
3:49.814 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(2), bloodsoaked_counter(21)
3:51.300 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), bloodsoaked_counter(22)
3:52.468 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(22)
3:53.915 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(22)
3:54.882 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(22)
3:55.850 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(4), starlord(3), torrent_of_elements, bloodsoaked_counter(23)
3:56.987 default K starsurge Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(4), starlord(3), torrent_of_elements, bloodsoaked_counter(26)
3:58.125 default O moonfire Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(27)
3:59.262 default P stellar_flare Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(28), conch_of_dark_whispers
4:00.398 default N sunfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(31), conch_of_dark_whispers
4:01.534 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(31), conch_of_dark_whispers
4:02.979 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(32), conch_of_dark_whispers
4:03.945 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(5), solar_empowerment, torrent_of_elements, bloodsoaked_counter(32), conch_of_dark_whispers
4:05.183 default G use_items Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, bloodsoaked_counter(33), conch_of_dark_whispers
4:05.183 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, bloodsoaked_counter(33), conch_of_dark_whispers, ignition_mages_fuse
4:06.649 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord, torrent_of_elements, bloodsoaked_counter(33), conch_of_dark_whispers, ignition_mages_fuse
4:07.627 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(6), solar_empowerment, starlord, bloodsoaked_counter(35), conch_of_dark_whispers, ignition_mages_fuse
4:08.605 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(6), starlord, bloodsoaked_counter(36), conch_of_dark_whispers, ignition_mages_fuse
4:09.758 default Q lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), bloodsoaked_counter(37), conch_of_dark_whispers, ignition_mages_fuse(2)
4:11.127 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), bloodsoaked_counter(39), conch_of_dark_whispers, ignition_mages_fuse(2)
4:12.041 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(7), starlord(2), bloodsoaked_counter(39), conch_of_dark_whispers, ignition_mages_fuse(2)
4:13.114 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), starlord(2), overwhelming_power(24), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(2)
4:14.046 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), starlord(2), overwhelming_power(23), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(3)
4:14.949 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(3)
4:16.068 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(21), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(3)
4:16.822 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(21), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.704 default N sunfire Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(20), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(4)
4:18.562 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(19), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(4)
4:19.421 default O moonfire Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(18), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(4)
4:20.283 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(17), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.146 default P stellar_flare Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(16), conch_of_dark_whispers, ignition_mages_fuse(4)
4:22.066 default R solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(15), bloodsoaked_counter(3), conch_of_dark_whispers, ignition_mages_fuse(5)
4:22.956 default R solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(15), bloodsoaked_counter(6), ignition_mages_fuse(5)
4:23.846 default J cancel_buff Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(14), bloodsoaked_counter(6), ignition_mages_fuse(5)
4:23.846 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(8), overwhelming_power(14), bloodsoaked_counter(6), ignition_mages_fuse(5)
4:24.817 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13), bloodsoaked_counter(6), ignition_mages_fuse(5)
4:25.572 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(12), bloodsoaked_counter(7)
4:26.573 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(11), bloodsoaked_counter(7)
4:27.402 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(10), bloodsoaked_counter(7)
4:28.383 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(9), bloodsoaked_counter(9), conch_of_dark_whispers
4:29.197 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(8), bloodsoaked_counter(10), conch_of_dark_whispers
4:30.419 default L sunfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(7), bloodsoaked_counter(10), conch_of_dark_whispers
4:31.383 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(6), bloodsoaked_counter(11), conch_of_dark_whispers
4:32.798 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(5), bloodsoaked_counter(13), conch_of_dark_whispers
4:33.914 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(4), bloodsoaked_counter(14), conch_of_dark_whispers
4:35.341 default H blood_of_the_enemy Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2), bloodsoaked_counter(14), conch_of_dark_whispers
4:36.471 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power seething_rage, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power, bloodsoaked_counter(15), conch_of_dark_whispers
4:37.914 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power seething_rage, arcanic_pulsar(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(16), conch_of_dark_whispers
4:38.882 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power seething_rage, arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(25), bloodsoaked_counter(17), conch_of_dark_whispers
4:40.207 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power seething_rage, arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(23), bloodsoaked_counter(17), conch_of_dark_whispers
4:41.097 default O moonfire Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(22), bloodsoaked_counter(19), conch_of_dark_whispers
4:42.148 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(21), bloodsoaked_counter(19), conch_of_dark_whispers
4:43.043 default R solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(20), bloodsoaked_counter(19), conch_of_dark_whispers
4:44.101 default K starsurge Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(3), lunar_empowerment, overwhelming_power(19), bloodsoaked_counter(19), conch_of_dark_whispers
4:45.256 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(18), bloodsoaked_counter(22), conch_of_dark_whispers
4:46.382 default P stellar_flare Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(17), bloodsoaked_counter(25), conch_of_dark_whispers
4:47.480 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(16), bloodsoaked_counter(26), conch_of_dark_whispers
4:48.884 default N sunfire Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(15), bloodsoaked_counter(28), conch_of_dark_whispers
4:49.990 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(14), bloodsoaked_counter(28), conch_of_dark_whispers
4:50.935 default Q lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(13), bloodsoaked_counter(28), conch_of_dark_whispers
4:52.354 default R solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(11), bloodsoaked_counter(29)
4:53.307 default K starsurge Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(10), bloodsoaked_counter(30)
4:54.435 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(9), bloodsoaked_counter(31)
4:55.371 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(8), bloodsoaked_counter(31)
4:56.777 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7), bloodsoaked_counter(32)
4:57.886 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(6), bloodsoaked_counter(32)
4:58.831 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(5), bloodsoaked_counter(32)
5:00.251 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(3), bloodsoaked_counter(32)
5:01.682 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(2), bloodsoaked_counter(34)
5:02.640 default O moonfire Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power, bloodsoaked_counter(34)
5:03.771 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), bloodsoaked_counter(34)
5:04.736 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(7), bloodsoaked_counter(35)
5:05.976 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(36)
5:07.506 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(8), solar_empowerment, starlord, bloodsoaked_counter(37)
5:08.709 default N sunfire Fluffy_Pillow 34.5/100: 35% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked
5:09.654 default P stellar_flare Fluffy_Pillow 38.0/100: 38% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked
5:10.599 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked
5:11.544 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked
5:12.325 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked
5:13.496 default L sunfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked
5:14.416 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked
5:15.312 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked
5:16.367 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked
5:17.266 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3)
5:18.714 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter
5:19.681 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(2)
5:21.129 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(3)
5:22.576 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(3)
5:23.543 default R solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), bloodsoaked_counter(3)
5:24.509 default R solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), bloodsoaked_counter(3)
5:25.647 default K starsurge Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar(2), lunar_empowerment, bloodsoaked_counter(3)
5:26.885 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter(3)
5:28.087 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2), bloodsoaked_counter(3), conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="blood of the enemy"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

focusing iris : 42810 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
42810.3 42810.3 22.3 / 0.052% 5238.7 / 12.2% 4970.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.6 8.5 Astral Power 0.00% 60.7 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
focusing iris 42810
Heed My Call 317 (453) 0.7% (1.1%) 8.6 32.01sec 15768 0 Direct 8.6 9127 18252 11037 20.9%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.60 8.60 0.00 0.00 0.0000 0.0000 94901.20 94901.20 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.80 79.07% 9127.05 8921 9813 9126.40 0 9813 62054 62054 0.00
crit 1.80 20.93% 18251.67 17842 19626 15404.35 0 19626 32847 32847 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 136 0.3% 8.6 32.01sec 4732 0 Direct 8.6 3912 7820 4732 21.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.60 8.60 0.00 0.00 0.0000 0.0000 40685.13 40685.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.80 79.03% 3911.85 3823 4206 3911.55 0 4206 26581 26581 0.00
crit 1.80 20.97% 7820.22 7646 8411 6567.15 0 8411 14104 14104 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6265 14.7% 81.6 3.60sec 22998 18490 Direct 81.6 18977 38634 22998 20.5%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.57 81.57 0.00 0.00 1.2439 0.0000 1875857.80 1875857.80 0.00 18489.55 18489.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.88 79.54% 18977.23 10135 24211 18982.89 18238 19892 1231238 1231238 0.00
crit 16.69 20.46% 38633.57 20270 48422 38666.34 34849 43657 644620 644620 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3052 7.1% 14.2 21.29sec 64408 66223 Direct 14.2 3262 6628 3939 20.1%  
Periodic 233.5 3013 6152 3672 21.0% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.18 14.18 233.51 233.51 0.9726 1.2750 913340.82 913340.82 0.00 2931.87 66222.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.33 79.89% 3262.10 2981 4065 3262.82 2981 3609 36958 36958 0.00
crit 2.85 20.11% 6628.22 5963 8130 6352.30 0 8130 18897 18897 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.5 79.01% 3013.10 2 3785 3014.35 2931 3146 555891 555891 0.00
crit 49.0 20.99% 6152.43 8 7570 6156.51 5777 6730 301595 301595 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 981 2.3% 46.6 6.28sec 6306 0 Direct 46.6 5178 10569 6306 20.9%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.58 46.58 0.00 0.00 0.0000 0.0000 293742.72 293742.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.83 79.07% 5177.65 4769 6503 5179.50 4841 5706 190706 190706 0.00
crit 9.75 20.93% 10569.23 9539 13006 10574.55 0 13006 103037 103037 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3570 (5662) 8.3% (13.2%) 100.8 2.92sec 16807 19255 Direct 101.3 8665 17676 10552 20.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.84 101.31 0.00 0.00 0.8729 0.0000 1068956.97 1068956.97 0.00 19255.23 19255.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.09 79.06% 8664.55 7949 10838 8669.27 8384 9171 693970 693970 0.00
crit 21.21 20.94% 17675.75 15898 21676 17691.42 16136 19534 374987 374987 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2091 4.9% 78.4 3.74sec 7984 0 Direct 78.4 7984 0 7984 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.40 78.40 0.00 0.00 0.0000 0.0000 625926.85 625926.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.40 100.00% 7983.97 5962 16257 7991.27 6911 9547 625927 625927 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6557.86
  • base_dd_max:6557.86
  • base_dd_mult:1.00
 
Starsurge 14553 34.0% 64.4 4.70sec 67628 67250 Direct 64.2 55811 113711 67851 20.8%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.39 64.18 0.00 0.00 1.0056 0.0000 4354644.13 4354644.13 0.00 67250.08 67250.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.83 79.21% 55811.32 51347 69612 55832.80 53207 58837 2837132 2837132 0.00
crit 13.35 20.79% 113710.52 102695 139223 113820.56 102695 130091 1517512 1517512 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1981 4.6% 12.8 23.56sec 46316 47278 Direct 12.8 2780 5662 3369 20.4%  
Periodic 231.1 1952 3985 2379 21.0% 98.5%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.80 12.80 231.10 231.10 0.9797 1.2772 592819.02 592819.02 0.00 1926.71 47278.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.19 79.57% 2780.04 2570 3504 2781.01 2570 3083 28315 28315 0.00
crit 2.61 20.43% 5662.23 5140 7009 5364.43 0 7009 14803 14803 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.6 79.03% 1952.36 1 2453 1953.18 1896 2040 356572 356572 0.00
crit 48.5 20.97% 3985.40 122 4906 3987.81 3742 4305 193128 193128 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6486 15.1% 94.4 2.99sec 20443 0 Direct 94.4 16389 32745 20444 24.8%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.44 94.44 0.00 0.00 0.0000 0.0000 1930663.40 1930663.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.03 75.21% 16389.36 16021 17623 16389.28 16021 17351 1164137 1164137 0.00
crit 23.41 24.79% 32744.66 32042 35246 32742.91 32042 34955 766527 766527 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3378 7.9% 17.6 17.01sec 57358 58403 Direct 17.6 4492 9040 5368 19.3%  
Periodic 232.6 3236 6605 3940 20.9% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.63 17.63 232.61 232.61 0.9821 1.2759 1011188.16 1011188.16 0.00 3219.42 58402.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.23 80.72% 4491.52 4112 5607 4492.75 4194 4885 63914 63914 0.00
crit 3.40 19.28% 9039.57 8225 11214 8815.91 0 11214 30730 30730 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.0 79.10% 3236.15 2 4065 3237.50 3144 3388 595405 595405 0.00
crit 48.6 20.90% 6604.93 4 8130 6609.15 6146 7161 321140 321140 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
focusing iris
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.64sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.46sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8713 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.6 56.6 42.1sec 4.7sec 93.40% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.30%
  • arcanic_pulsar_2:11.33%
  • arcanic_pulsar_3:11.60%
  • arcanic_pulsar_4:10.79%
  • arcanic_pulsar_5:12.53%
  • arcanic_pulsar_6:11.02%
  • arcanic_pulsar_7:11.76%
  • arcanic_pulsar_8:13.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.4sec 0.0sec 16.23% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.12% 8.39% 0.0(0.0) 2.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 7.9 0.0 39.9sec 39.9sec 26.69% 33.05% 0.0(0.0) 7.7

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.1 61.2sec 45.8sec 23.58% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Focused Energy 1.0 381.5 0.0sec 0.8sec 100.00% 99.73% 374.5(374.5) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_focused_energy
  • max_stacks:10
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:35.52

Stack Uptimes

  • focused_energy_3:0.41%
  • focused_energy_4:0.31%
  • focused_energy_5:0.40%
  • focused_energy_6:0.21%
  • focused_energy_7:0.20%
  • focused_energy_8:0.20%
  • focused_energy_9:0.19%
  • focused_energy_10:98.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295248
  • name:Focused Energy
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc295246=Your damaging spells and abilities grant you {$s2=0} Haste for {$295248d=4 seconds}, stacking up to {$295248u=10} times. This Haste is lost if you stop using spells or abilities against the initial target.$?a295252[ When you have no stacks of Focused Energy, generate {$s1=1} stacks from your first damaging spell or ability.][]}
  • max_stacks:10
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.25% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.96%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 37.0 47.7 8.2sec 3.6sec 81.64% 99.73% 2.1(2.1) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.01%
  • lunar_empowerment_2:30.79%
  • lunar_empowerment_3:14.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 399.2(399.2) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.7 3.8 63.4sec 32.5sec 49.62% 0.00% 3.8(52.6) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.40%
  • overwhelming_power_2:1.44%
  • overwhelming_power_3:1.48%
  • overwhelming_power_4:1.53%
  • overwhelming_power_5:1.57%
  • overwhelming_power_6:1.62%
  • overwhelming_power_7:1.66%
  • overwhelming_power_8:1.71%
  • overwhelming_power_9:1.77%
  • overwhelming_power_10:1.82%
  • overwhelming_power_11:1.87%
  • overwhelming_power_12:1.93%
  • overwhelming_power_13:1.99%
  • overwhelming_power_14:2.05%
  • overwhelming_power_15:2.11%
  • overwhelming_power_16:2.18%
  • overwhelming_power_17:2.24%
  • overwhelming_power_18:2.31%
  • overwhelming_power_19:2.39%
  • overwhelming_power_20:2.46%
  • overwhelming_power_21:2.54%
  • overwhelming_power_22:2.62%
  • overwhelming_power_23:2.71%
  • overwhelming_power_24:2.79%
  • overwhelming_power_25:1.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 27.6 53.1 10.9sec 3.7sec 84.40% 77.52% 0.2(0.2) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:29.72%
  • solar_empowerment_2:38.72%
  • solar_empowerment_3:15.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 49.1 20.2sec 4.7sec 97.93% 93.15% 18.8(18.8) 11.3

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:13.29%
  • starlord_2:21.66%
  • starlord_3:62.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.9sec 45.5sec 23.65% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.65%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
focusing iris
starsurge Astral Power 64.4 2575.7 40.0 40.0 1690.7
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 101.84 814.70 (32.10%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.15%) 40.00 0.00 0.00%
sunfire Astral Power 17.63 52.89 (2.08%) 3.00 0.00 0.00%
shooting_stars Astral Power 46.58 186.33 (7.34%) 4.00 0.00 0.00%
moonfire Astral Power 14.18 42.54 (1.68%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.80 102.40 (4.03%) 8.00 0.00 0.00%
lunar_strike Astral Power 81.56 978.71 (38.56%) 12.00 0.07 0.01%
natures_balance Astral Power 400.21 200.10 (7.88%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.68 80.21 (3.16%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.47 8.59
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.84 0.00 55.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data focusing iris Fight Length
Count 14412
Mean 299.78
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data focusing iris Damage Per Second
Count 14412
Mean 42810.32
Minimum 38655.02
Maximum 48290.51
Spread ( max - min ) 9635.49
Range [ ( max - min ) / 2 * 100% ] 11.25%
Standard Deviation 1363.4754
5th Percentile 40687.56
95th Percentile 45152.07
( 95th Percentile - 5th Percentile ) 4464.51
Mean Distribution
Standard Deviation 11.3576
95.00% Confidence Intervall ( 42788.06 - 42832.58 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3897
0.1 Scale Factor Error with Delta=300 15871
0.05 Scale Factor Error with Delta=300 63481
0.01 Scale Factor Error with Delta=300 1587006
Priority Target DPS
Sample Data focusing iris Priority Target Damage Per Second
Count 14412
Mean 42810.32
Minimum 38655.02
Maximum 48290.51
Spread ( max - min ) 9635.49
Range [ ( max - min ) / 2 * 100% ] 11.25%
Standard Deviation 1363.4754
5th Percentile 40687.56
95th Percentile 45152.07
( 95th Percentile - 5th Percentile ) 4464.51
Mean Distribution
Standard Deviation 11.3576
95.00% Confidence Intervall ( 42788.06 - 42832.58 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3897
0.1 Scale Factor Error with Delta=300 15871
0.05 Scale Factor Error with Delta=300 63481
0.01 Scale Factor Error with Delta=300 1587006
DPS(e)
Sample Data focusing iris Damage Per Second (Effective)
Count 14412
Mean 42810.32
Minimum 38655.02
Maximum 48290.51
Spread ( max - min ) 9635.49
Range [ ( max - min ) / 2 * 100% ] 11.25%
Damage
Sample Data focusing iris Damage
Count 14412
Mean 12802726.19
Minimum 9964135.37
Maximum 15933052.55
Spread ( max - min ) 5968917.18
Range [ ( max - min ) / 2 * 100% ] 23.31%
DTPS
Sample Data focusing iris Damage Taken Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data focusing iris Healing Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data focusing iris Healing Per Second (Effective)
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data focusing iris Heal
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data focusing iris Healing Taken Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data focusing iris Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data focusing irisTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data focusing iris Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 3.10 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 64.39 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 2.66 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 2.82 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 14.64 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
N 11.36 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.80 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 81.93 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 101.10 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.33 sunfire

Sample Sequence

0123456789ACDJNMOHFGJQJQPQPJQPJQPQMQNQPQIJQOQPJPJPPPQQJQJQPJQPKPNPJPJQPOQJPQMQJPQQQQQJNPJQPQJMOQPJLPQQQQJPQJPMQQQJOPPQNQPQJJPMPQJQPPJQPOQNQQQJMGJQPJKPPJQPPJQPPQNOJPPJMQPQJPQQQJPQQQQJNOJQPKPJQPQPJQPPQQMJHEFJNQOQPJQPJQPJQPQPQPQJMJQJQPLPJOPPJMQPQQQJPJNPQQJPPMJOQPQQQGQJQJQPJQLPPJMPQQJOPPQQJPQJPQMNQJPQQQQQOQJJQPQJQKNPJPPQPQQQQJJMOPPJQPNQJQPPQQPJP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask focusing iris 58.0/100: 58% astral_power
Pre precombat 1 food focusing iris 58.0/100: 58% astral_power
Pre precombat 2 augmentation focusing iris 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power focused_energy(3), battle_potion_of_intellect
0:01.223 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, focused_energy(3), battle_potion_of_intellect
0:02.138 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, focused_energy(4), battle_potion_of_intellect
0:03.050 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, focused_energy(5), battle_potion_of_intellect
0:03.954 default H celestial_alignment Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(7), battle_potion_of_intellect
0:04.736 default F berserking Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(8), battle_potion_of_intellect
0:04.736 default G use_items Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(8), battle_potion_of_intellect
0:04.736 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(8), battle_potion_of_intellect, ignition_mages_fuse
0:05.491 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(9), battle_potion_of_intellect, ignition_mages_fuse
0:06.246 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:07.000 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:07.753 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:08.565 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:09.318 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.098 default J starsurge Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.854 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.608 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.387 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.142 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:13.897 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(25), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.653 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(24), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.407 default M sunfire Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(23), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.162 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(22), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.915 default N moonfire Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(22), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.669 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(21), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.423 default P lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(20), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.176 default Q solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(19), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.929 default I cancel_buff Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(19), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.929 default J starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), overwhelming_power(19), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.683 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(18), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.437 default O stellar_flare Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(17), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.192 default Q solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(16), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.947 default P lunar_strike Fluffy_Pillow 85.0/100: 85% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(16), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.723 default J starsurge Fluffy_Pillow 97.5/100: 98% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(15), focused_energy(10), ignition_mages_fuse(5)
0:24.477 default P lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(14), focused_energy(10), ignition_mages_fuse(5)
0:25.348 default J starsurge Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(13), focused_energy(10)
0:26.173 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(25), focused_energy(10)
0:27.155 default P lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), focused_energy(10)
0:28.140 default P lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), focused_energy(10)
0:29.127 default Q solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), focused_energy(10)
0:29.884 default Q solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), focused_energy(10)
0:30.638 default J starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(21), focused_energy(10)
0:31.420 default Q solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), focused_energy(10)
0:32.175 default J starsurge Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), focused_energy(10)
0:32.931 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), focused_energy(10)
0:33.685 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(18), focused_energy(10)
0:34.560 default J starsurge Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17), focused_energy(10)
0:35.315 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), focused_energy(10)
0:36.070 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), focused_energy(10)
0:36.924 default K sunfire Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), focused_energy(10)
0:37.679 default P lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), focused_energy(10)
0:38.667 default N moonfire Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), focused_energy(10)
0:39.447 default P lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), focused_energy(10)
0:40.440 default J starsurge Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, arcanic_pulsar(2), solar_empowerment, torrent_of_elements, overwhelming_power(20), focused_energy(10)
0:41.293 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(19), focused_energy(10)
0:42.668 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(18), focused_energy(10)
0:43.753 default Q solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(17), focused_energy(10)
0:44.653 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(16), focused_energy(10)
0:46.004 default O stellar_flare Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(14), focused_energy(10)
0:47.073 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(13), focused_energy(10)
0:47.984 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), overwhelming_power(13), focused_energy(10)
0:49.056 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11), focused_energy(10)
0:50.393 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(10), focused_energy(10)
0:51.286 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(9), focused_energy(10)
0:52.340 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(8), focused_energy(10)
0:53.239 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(7), focused_energy(10)
0:54.302 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(6), focused_energy(10)
0:55.661 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(5), focused_energy(10)
0:56.571 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(4), focused_energy(10)
0:57.483 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(3), focused_energy(10)
0:58.561 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(2), focused_energy(10)
0:59.642 default Q solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power, focused_energy(10)
1:00.729 default J starsurge Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(6), focused_energy(10)
1:01.917 default N moonfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
1:03.071 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
1:04.539 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord, focused_energy(10)
1:05.692 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), focused_energy(10)
1:06.647 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
1:08.073 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), focused_energy(10)
1:09.026 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), focused_energy(10)
1:10.146 default M sunfire Fluffy_Pillow 12.5/100: 13% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
1:11.095 default O stellar_flare Fluffy_Pillow 16.0/100: 16% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
1:12.046 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
1:12.854 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
1:14.061 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
1:15.010 default L moonfire Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
1:15.959 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
1:17.346 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
1:18.275 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
1:19.202 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, focused_energy(10)
1:20.291 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, focused_energy(10)
1:21.380 default J starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, torrent_of_elements, focused_energy(10)
1:22.568 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, focused_energy(10)
1:24.037 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(2), solar_empowerment, starlord, torrent_of_elements, focused_energy(10)
1:25.017 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(2), starlord, torrent_of_elements, focused_energy(10)
1:26.172 default P lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, focused_energy(10)
1:27.599 default M sunfire Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), torrent_of_elements, focused_energy(10)
1:28.720 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), torrent_of_elements, focused_energy(10)
1:29.672 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(3), starlord(2), torrent_of_elements, focused_energy(10)
1:30.793 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(3), starlord(2), torrent_of_elements, focused_energy(10)
1:31.913 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(2), torrent_of_elements, focused_energy(10)
1:33.033 default O stellar_flare Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
1:34.123 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
1:35.510 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
1:36.899 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3), torrent_of_elements, focused_energy(10)
1:37.825 default N moonfire Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
1:38.915 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
1:39.841 default P lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10)
1:41.228 default Q solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), focused_energy(10)
1:42.154 default J starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(4), lunar_empowerment, focused_energy(10)
1:43.340 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord, focused_energy(10)
1:44.492 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(2), focused_energy(10)
1:45.917 default M sunfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
1:47.037 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
1:48.463 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), focused_energy(10)
1:49.416 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
1:50.536 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10)
1:51.462 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), focused_energy(10)
1:52.741 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), focused_energy(10)
1:54.023 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(21), focused_energy(10)
1:55.036 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(20), focused_energy(10)
1:55.900 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20), focused_energy(10)
1:57.195 default O stellar_flare Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(18), focused_energy(10)
1:58.219 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(17), focused_energy(10), conch_of_dark_whispers
1:59.094 default N moonfire Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(16), focused_energy(10), conch_of_dark_whispers
2:00.125 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(15), focused_energy(10), conch_of_dark_whispers
2:01.003 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(14), focused_energy(10), conch_of_dark_whispers
2:01.883 default Q solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(14), focused_energy(10), conch_of_dark_whispers
2:02.922 default J starsurge Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(8), lunar_empowerment, overwhelming_power(13), focused_energy(10), conch_of_dark_whispers
2:04.055 default M sunfire Fluffy_Pillow 62.5/100: 63% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(11), focused_energy(10), conch_of_dark_whispers
2:05.020 default G use_items Fluffy_Pillow 70.0/100: 70% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(10), focused_energy(10), conch_of_dark_whispers
2:05.020 default J starsurge Fluffy_Pillow 70.0/100: 70% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(10), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
2:05.951 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(10), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
2:06.721 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(9), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
2:07.875 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(8), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
2:08.785 default K sunfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(7), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
2:09.675 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(6), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
2:10.929 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(5), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.187 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.181 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(2), focused_energy(10), ignition_mages_fuse(3)
2:13.998 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(2), focused_energy(10), ignition_mages_fuse(3)
2:15.221 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), ignition_mages_fuse(3)
2:16.452 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), ignition_mages_fuse(3)
2:17.419 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10), ignition_mages_fuse(4)
2:18.211 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), ignition_mages_fuse(4)
2:19.398 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), ignition_mages_fuse(4)
2:20.586 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), focused_energy(10), ignition_mages_fuse(4)
2:21.379 default N moonfire Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), ignition_mages_fuse(5)
2:22.276 default O stellar_flare Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), ignition_mages_fuse(5)
2:23.176 default J starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, focused_energy(10), ignition_mages_fuse(5)
2:24.156 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, focused_energy(10), ignition_mages_fuse(5)
2:25.367 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, focused_energy(10)
2:26.835 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, focused_energy(10)
2:27.987 default M sunfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), focused_energy(10)
2:29.106 default Q solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(25), focused_energy(10)
2:29.982 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25), focused_energy(10)
2:31.292 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(23), focused_energy(10)
2:32.173 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(22), focused_energy(10)
2:33.211 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), focused_energy(10)
2:34.501 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(20), focused_energy(10)
2:35.367 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(19), focused_energy(10)
2:36.234 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(18), focused_energy(10)
2:37.258 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(17), focused_energy(10)
2:38.285 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24), focused_energy(10)
2:39.563 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(23), focused_energy(10)
2:40.417 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(22), focused_energy(10)
2:41.428 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(21), focused_energy(10)
2:42.443 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(20), focused_energy(10)
2:43.462 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(8), overwhelming_power(19), focused_energy(10)
2:44.573 default N moonfire Fluffy_Pillow 25.5/100: 26% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18), focused_energy(10)
2:45.514 default O stellar_flare Fluffy_Pillow 33.0/100: 33% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(17), focused_energy(10)
2:46.459 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(16), focused_energy(10), conch_of_dark_whispers
2:47.406 default Q solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(15), focused_energy(10), conch_of_dark_whispers
2:48.193 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(14), focused_energy(10), conch_of_dark_whispers
2:49.374 default K sunfire Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(13), focused_energy(10), conch_of_dark_whispers
2:50.305 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(12), focused_energy(10), conch_of_dark_whispers
2:51.672 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(11), focused_energy(10), conch_of_dark_whispers
2:52.748 default Q solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(10), focused_energy(10), conch_of_dark_whispers
2:53.642 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), focused_energy(10), conch_of_dark_whispers
2:54.920 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23), focused_energy(10), conch_of_dark_whispers
2:55.775 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), focused_energy(10), conch_of_dark_whispers
2:57.063 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20), focused_energy(10), conch_of_dark_whispers
2:58.079 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(19), focused_energy(10), conch_of_dark_whispers
2:58.947 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), focused_energy(10), conch_of_dark_whispers
3:00.248 default P lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), focused_energy(10), conch_of_dark_whispers
3:01.554 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(16), focused_energy(10)
3:02.430 default Q solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(15), focused_energy(10)
3:03.309 default M sunfire Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(14), focused_energy(10)
3:04.347 default J starsurge Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(3), overwhelming_power(13), focused_energy(10)
3:05.481 default H celestial_alignment Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(12), focused_energy(10)
3:06.443 default E potion Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(11), focused_energy(10)
3:06.443 default F berserking Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(11), focused_energy(10), battle_potion_of_intellect
3:06.443 default J starsurge Fluffy_Pillow 85.0/100: 85% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(11), focused_energy(10), battle_potion_of_intellect
3:07.320 default N moonfire Fluffy_Pillow 45.5/100: 46% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(10), focused_energy(10), battle_potion_of_intellect
3:08.179 default Q solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(9), focused_energy(10), battle_potion_of_intellect
3:08.934 default O stellar_flare Fluffy_Pillow 57.5/100: 57% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(9), focused_energy(10), battle_potion_of_intellect
3:09.792 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(8), focused_energy(10), battle_potion_of_intellect
3:10.547 default P lunar_strike Fluffy_Pillow 75.0/100: 75% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(7), focused_energy(10), battle_potion_of_intellect
3:11.648 default J starsurge Fluffy_Pillow 87.5/100: 88% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(6), focused_energy(10), battle_potion_of_intellect
3:12.516 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(5), focused_energy(10), battle_potion_of_intellect
3:13.272 default P lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(4), focused_energy(10), battle_potion_of_intellect
3:14.355 default J starsurge Fluffy_Pillow 69.5/100: 70% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(3), focused_energy(10), battle_potion_of_intellect
3:15.208 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(2), focused_energy(10), battle_potion_of_intellect
3:15.961 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(2), focused_energy(10), battle_potion_of_intellect
3:17.050 default J starsurge Fluffy_Pillow 59.0/100: 59% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:17.912 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power berserking, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:18.667 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:19.875 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:20.823 default P lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:22.030 default Q solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), focused_energy(10), battle_potion_of_intellect
3:22.903 default P lunar_strike Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), focused_energy(10), battle_potion_of_intellect
3:24.014 default Q solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(8), celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(22), focused_energy(10), battle_potion_of_intellect
3:24.893 default J starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(8), celestial_alignment, torrent_of_elements, overwhelming_power(22), focused_energy(10), battle_potion_of_intellect
3:25.850 default M sunfire Fluffy_Pillow 65.0/100: 65% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(21), focused_energy(10), battle_potion_of_intellect
3:26.783 default J starsurge Fluffy_Pillow 72.5/100: 73% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(20), focused_energy(10), battle_potion_of_intellect
3:27.720 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19), focused_energy(10), battle_potion_of_intellect
3:28.496 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(18), focused_energy(10), battle_potion_of_intellect
3:29.412 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), focused_energy(10), battle_potion_of_intellect
3:30.171 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16), focused_energy(10), battle_potion_of_intellect
3:31.314 default L moonfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15), focused_energy(10), battle_potion_of_intellect
3:32.215 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14), focused_energy(10)
3:33.537 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(13), focused_energy(10)
3:34.579 default O stellar_flare Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12), focused_energy(10)
3:35.624 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11), focused_energy(10)
3:36.960 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), focused_energy(10)
3:38.299 default J starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8), focused_energy(10)
3:39.358 default M sunfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(7), focused_energy(10)
3:40.423 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(6), focused_energy(10)
3:41.330 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5), focused_energy(10)
3:42.693 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(4), focused_energy(10)
3:43.606 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(3), focused_energy(10)
3:44.524 default Q solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(2), focused_energy(10)
3:45.605 default J starsurge Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(4), overwhelming_power, focused_energy(10)
3:46.789 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(25), focused_energy(10)
3:48.137 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(5), solar_empowerment, starlord, overwhelming_power(23), focused_energy(10)
3:49.202 default N moonfire Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22), focused_energy(10)
3:50.240 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(21), focused_energy(10)
3:51.566 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(20), focused_energy(10)
3:52.453 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(19), focused_energy(10)
3:53.345 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(2), overwhelming_power(18), focused_energy(10)
3:54.397 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17), focused_energy(10)
3:55.704 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(16), focused_energy(10)
3:57.019 default M sunfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(14), focused_energy(10)
3:58.057 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(13), focused_energy(10)
3:59.098 default O stellar_flare Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(12), focused_energy(10)
4:00.141 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(11), focused_energy(10)
4:01.033 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10), focused_energy(10)
4:02.374 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(9), focused_energy(10)
4:03.271 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(8), focused_energy(10)
4:04.171 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(7), focused_energy(10)
4:05.076 default G use_items Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(6), focused_energy(10)
4:05.076 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(6), focused_energy(10), ignition_mages_fuse
4:06.098 default J starsurge Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(8), overwhelming_power(5), focused_energy(10), ignition_mages_fuse
4:07.220 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(4), focused_energy(10), ignition_mages_fuse
4:08.027 default J starsurge Fluffy_Pillow 60.0/100: 60% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(3), focused_energy(10), ignition_mages_fuse
4:08.980 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(3), focused_energy(10), ignition_mages_fuse
4:09.766 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(2), focused_energy(10), ignition_mages_fuse(2)
4:10.902 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power, focused_energy(10), ignition_mages_fuse(2)
4:11.799 default Q solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), ignition_mages_fuse(2)
4:12.553 default L moonfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10), ignition_mages_fuse(2)
4:13.426 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), focused_energy(10), ignition_mages_fuse(3)
4:14.659 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), focused_energy(10), ignition_mages_fuse(3)
4:15.889 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(2), starlord(3), focused_energy(10), ignition_mages_fuse(3)
4:16.855 default M sunfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), ignition_mages_fuse(3)
4:17.823 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), ignition_mages_fuse(4)
4:19.010 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), focused_energy(10), ignition_mages_fuse(4)
4:19.802 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), focused_energy(10), ignition_mages_fuse(4)
4:20.594 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), focused_energy(10), ignition_mages_fuse(4)
4:21.527 default O stellar_flare Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), ignition_mages_fuse(5)
4:22.425 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), ignition_mages_fuse(5)
4:23.571 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), ignition_mages_fuse(5)
4:24.717 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), focused_energy(10), ignition_mages_fuse(5)
4:25.479 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(4), starlord(3), focused_energy(10)
4:26.570 default J starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(4), focused_energy(10)
4:27.758 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
4:29.226 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), solar_empowerment, starlord, focused_energy(10)
4:30.206 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(5), starlord, focused_energy(10)
4:31.359 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, focused_energy(10)
4:32.784 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), torrent_of_elements, focused_energy(10)
4:33.738 default M sunfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(6), starlord(2), torrent_of_elements, focused_energy(10)
4:34.859 default N moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(6), starlord(2), torrent_of_elements, focused_energy(10)
4:35.980 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(6), starlord(2), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
4:37.100 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), starlord(2), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
4:38.220 default P lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
4:39.608 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
4:40.534 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
4:41.623 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
4:42.712 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
4:43.802 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
4:44.891 default O stellar_flare Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
4:45.981 default Q solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(7), starlord(3), focused_energy(10), conch_of_dark_whispers
4:47.070 default J starsurge Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(7), lunar_empowerment, focused_energy(10), conch_of_dark_whispers
4:48.255 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, focused_energy(10), conch_of_dark_whispers
4:49.408 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers
4:50.238 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), focused_energy(10)
4:51.478 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
4:52.306 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), focused_energy(10)
4:53.281 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10)
4:54.088 default K sunfire Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10)
4:55.037 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10)
4:56.126 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10)
4:57.514 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10)
4:58.603 default P lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10)
4:59.990 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10)
5:01.377 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)
5:02.303 default P lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
5:03.690 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(25), focused_energy(10)
5:04.539 default Q solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(24), focused_energy(10)
5:05.392 default Q solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(23), focused_energy(10)
5:06.399 default Q solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(22), focused_energy(10)
5:07.410 default J starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(2), overwhelming_power(21), focused_energy(10)
5:08.513 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(20), focused_energy(10)
5:09.586 default M sunfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19), focused_energy(10)
5:10.632 default O stellar_flare Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(18), focused_energy(10)
5:11.685 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(17), focused_energy(10)
5:13.030 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(15), focused_energy(10)
5:14.385 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(14), focused_energy(10)
5:15.451 default Q solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(13), focused_energy(10)
5:16.337 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(12), focused_energy(10)
5:17.667 default N moonfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(11), focused_energy(10)
5:18.715 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(10), focused_energy(10)
5:19.609 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9), focused_energy(10)
5:20.665 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(8), focused_energy(10)
5:21.567 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7), focused_energy(10)
5:22.919 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(6), focused_energy(10)
5:24.278 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), overwhelming_power(4), focused_energy(10)
5:25.190 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(3), focused_energy(10)
5:26.108 default P lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(2), focused_energy(10)
5:27.487 default J starsurge Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(6), solar_empowerment, overwhelming_power, focused_energy(10)
5:28.668 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, focused_energy(10)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="focusing iris"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

lucid dreams : 44235 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
44234.7 44234.7 24.1 / 0.055% 5710.7 / 12.9% 4545.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
9.7 9.6 Astral Power 0.00% 59.6 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
lucid dreams 44235
Heed My Call 309 (441) 0.7% (1.0%) 8.3 33.03sec 15940 0 Direct 8.3 9229 18453 11164 21.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.29 8.29 0.00 0.00 0.0000 0.0000 92518.15 92518.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.55 79.02% 9229.46 8921 10228 9226.85 0 10228 60441 60441 0.00
crit 1.74 20.98% 18453.49 17842 20456 15356.73 0 20456 32077 32077 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 132 0.3% 8.3 33.03sec 4776 0 Direct 8.3 3955 7912 4775 20.7%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.29 8.29 0.00 0.00 0.0000 0.0000 39575.35 39575.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.57 79.26% 3954.97 3823 4384 3954.15 0 4384 25979 25979 0.00
crit 1.72 20.74% 7912.50 7646 8767 6541.03 0 8767 13597 13597 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5950 13.5% 76.9 3.80sec 23165 17774 Direct 76.9 19202 38848 23165 20.2%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.95 76.95 0.00 0.00 1.3033 0.0000 1782533.22 1782533.22 0.00 17774.50 17774.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.43 79.83% 19202.19 10135 25236 19209.47 18439 20254 1179563 1179563 0.00
crit 15.52 20.17% 38848.43 21848 50471 38873.42 35162 44872 602971 602971 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2974 6.7% 14.2 21.23sec 62720 61998 Direct 14.2 3280 6636 3947 19.9%  
Periodic 224.5 3058 6214 3715 20.8% 99.2%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.19 14.19 224.54 224.54 1.0117 1.3247 890235.00 890235.00 0.00 2855.04 61998.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.37 80.10% 3279.69 2981 4237 3280.17 3026 3602 37288 37288 0.00
crit 2.82 19.90% 6635.71 5963 8474 6342.40 0 8474 18741 18741 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 177.8 79.17% 3057.86 2 3945 3059.19 2966 3200 543613 543613 0.00
crit 46.8 20.83% 6214.43 10 7890 6218.05 5789 6758 290592 290592 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 956 2.2% 44.8 6.53sec 6386 0 Direct 44.8 5255 10679 6386 20.8%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.80 44.80 0.00 0.00 0.0000 0.0000 286084.10 286084.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.46 79.15% 5255.32 4769 6778 5257.45 4962 5736 186353 186353 0.00
crit 9.34 20.85% 10679.39 9539 13556 10681.77 0 12962 99731 99731 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3061 (5236) 6.9% (11.8%) 85.1 3.44sec 18414 20881 Direct 85.8 8808 17889 10680 20.6%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.12 85.77 0.00 0.00 0.8819 0.0000 916031.06 916031.06 0.00 20881.48 20881.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.09 79.39% 8808.13 7949 11297 8812.46 8476 9304 599781 599781 0.00
crit 17.68 20.61% 17888.86 15898 22594 17903.27 16299 20325 316251 316251 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2176 4.9% 81.0 3.61sec 8042 0 Direct 81.0 8042 0 8042 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.99 80.99 0.00 0.00 0.0000 0.0000 651311.89 651311.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.99 100.00% 8041.92 5962 16945 8048.05 6950 9384 651312 651312 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6213.97
  • base_dd_max:6213.97
  • base_dd_mult:1.00
 
Starsurge 16720 37.8% 72.8 4.17sec 68750 66879 Direct 72.5 56663 115444 69038 21.1%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.76 72.45 0.00 0.00 1.0280 0.0000 5002004.93 5002004.93 0.00 66878.88 66878.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.20 78.95% 56663.28 51347 72557 56682.22 54686 59708 3241223 3241223 0.00
crit 15.25 21.05% 115444.26 102695 145115 115534.36 104367 131864 1760782 1760782 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1933 4.4% 12.8 23.58sec 45286 44356 Direct 12.8 2807 5692 3406 20.7%  
Periodic 222.2 1982 4030 2408 20.8% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.78 12.78 222.22 222.22 1.0210 1.3272 578715.58 578715.58 0.00 1879.14 44356.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.13 79.26% 2807.41 2570 3653 2808.21 2570 3120 28434 28434 0.00
crit 2.65 20.74% 5691.94 5140 7306 5413.16 0 7306 15088 15088 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 176.0 79.18% 1982.19 5 2557 1983.08 1920 2092 348777 348777 0.00
crit 46.3 20.82% 4029.59 11 5114 4031.78 3786 4359 186417 186417 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6724 15.1% 97.9 2.88sec 20467 0 Direct 97.9 16615 33211 20466 23.2%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.85 97.85 0.00 0.00 0.0000 0.0000 2002701.39 2002701.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.14 76.79% 16614.73 16021 18369 16614.48 16030 17529 1248470 1248470 0.00
crit 22.71 23.21% 33211.06 32042 36737 33209.00 32042 35923 754232 754232 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3300 7.5% 17.5 17.15sec 56582 55949 Direct 17.5 4560 9206 5476 19.7%  
Periodic 223.7 3282 6673 3988 20.8% 98.9%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.46 17.46 223.75 223.75 1.0114 1.3252 987897.97 987897.97 0.00 3144.38 55949.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.02 80.28% 4559.75 4112 5844 4560.59 4224 5019 63909 63909 0.00
crit 3.44 19.72% 9206.02 8225 11689 9016.18 0 11689 31703 31703 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 177.2 79.19% 3282.30 2 4237 3283.72 3171 3438 581579 581579 0.00
crit 46.6 20.81% 6672.80 26 8474 6676.45 6229 7250 310707 310707 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
lucid dreams
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.11sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 184.50sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8595 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&!buff.ca_inc.up&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Memory of Lucid Dreams 2.9 123.06sec

Stats details: memory_of_lucid_dreams

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 1.0052 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: memory_of_lucid_dreams

Static Values
  • id:298357
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.sunfire.remains>10&dot.moonfire.remains>10&(astral_power<40|cooldown.ca_inc.remains>30)&dot.stellar_flare.remains>10&!buff.ca_inc.up
Spelldata
  • id:298357
  • name:Memory of Lucid Dreams
  • school:physical
  • tooltip:$?a300120[Shield of the Righteous recharge rate increased by ${{$300120s1=50}*-2}%]?a303412[Frostbolt and Flurry will generate an additional Icicle]?a303399[Fire Blast recharge rate increased by ${{$303399s1=50}*-2}%][{$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation increased by {$s1=100}%].$?$w2>0[ Leech increased by $w2.][]
  • description:Clear your mind and attune yourself with the Heart of Azeroth, $?a137028[increasing your Shield of the Righteous recharge rate by ${{$300120s1=50}*-2}%]?a137020[causing Frostbolt and Flurry to generate an additional Icicle]?a137019[increasing your Fire Blast recharge rate by ${{$303399s1=50}*-2}%][increasing your {$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation rate by {$s1=100}%]$?a298377[ and ][]$?a137020&a298377[increases ][]$?a298377[your Leech by {$298268s6=224}][] for {$d=12 seconds}.
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 8.5 64.0 37.4sec 4.2sec 92.41% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:10.59%
  • arcanic_pulsar_2:12.13%
  • arcanic_pulsar_3:11.98%
  • arcanic_pulsar_4:11.23%
  • arcanic_pulsar_5:10.96%
  • arcanic_pulsar_6:11.55%
  • arcanic_pulsar_7:11.83%
  • arcanic_pulsar_8:12.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 191.2sec 0.0sec 16.23% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.1sec 182.1sec 8.12% 8.05% 0.0(0.0) 2.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.4 0.0 37.1sec 37.1sec 28.44% 35.80% 0.0(0.0) 8.2

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:28.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.9sec 45.5sec 23.68% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.11% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.93%
  • ignition_mages_fuse_2:3.87%
  • ignition_mages_fuse_3:3.82%
  • ignition_mages_fuse_4:3.77%
  • ignition_mages_fuse_5:3.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lucid Dreams 8.4 2.6 34.6sec 25.9sec 25.39% 0.00% 2.6(2.6) 8.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_lucid_dreams
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:376.75

Stack Uptimes

  • lucid_dreams_1:25.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298343
  • name:Lucid Dreams
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc298339=When Lucid Dreams $?!a137020[refunds ][]$?a137028[part of a Shield of the Righteous charge]?a137019[part of a charge of Fire Blast]?a137020[generates an icicle][{$@spelldesc298373=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Runes]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]}], gain {$s1=0} Versatility for {$298343d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Lunar Empowerment 16.5 73.5 17.9sec 3.4sec 93.60% 99.99% 10.9(10.9) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:20.00%
  • lunar_empowerment_2:42.89%
  • lunar_empowerment_3:30.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Memory of Lucid Dreams 2.9 0.0 123.0sec 123.0sec 14.22% 16.59% 0.0(0.0) 2.8

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_memory_of_lucid_dreams
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:leech_rating
  • amount:0.00

Stack Uptimes

  • memory_of_lucid_dreams_1:14.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298357
  • name:Memory of Lucid Dreams
  • tooltip:$?a300120[Shield of the Righteous recharge rate increased by ${{$300120s1=50}*-2}%]?a303412[Frostbolt and Flurry will generate an additional Icicle]?a303399[Fire Blast recharge rate increased by ${{$303399s1=50}*-2}%][{$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation increased by {$s1=100}%].$?$w2>0[ Leech increased by $w2.][]
  • description:Clear your mind and attune yourself with the Heart of Azeroth, $?a137028[increasing your Shield of the Righteous recharge rate by ${{$300120s1=50}*-2}%]?a137020[causing Frostbolt and Flurry to generate an additional Icicle]?a137019[increasing your Fire Blast recharge rate by ${{$303399s1=50}*-2}%][increasing your {$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation rate by {$s1=100}%]$?a298377[ and ][]$?a137020&a298377[increases ][]$?a298377[your Leech by {$298268s6=224}][] for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 399.2(399.2) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.5 64.3sec 33.5sec 48.26% 0.00% 3.5(49.3) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.59%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.68%
  • overwhelming_power_9:1.73%
  • overwhelming_power_10:1.78%
  • overwhelming_power_11:1.83%
  • overwhelming_power_12:1.88%
  • overwhelming_power_13:1.94%
  • overwhelming_power_14:2.00%
  • overwhelming_power_15:2.05%
  • overwhelming_power_16:2.12%
  • overwhelming_power_17:2.18%
  • overwhelming_power_18:2.24%
  • overwhelming_power_19:2.31%
  • overwhelming_power_20:2.38%
  • overwhelming_power_21:2.46%
  • overwhelming_power_22:2.53%
  • overwhelming_power_23:2.61%
  • overwhelming_power_24:2.68%
  • overwhelming_power_25:1.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 9.2 78.9 27.8sec 3.4sec 96.53% 94.45% 4.3(4.3) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:13.27%
  • solar_empowerment_2:47.27%
  • solar_empowerment_3:35.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.8 57.0 19.6sec 4.2sec 98.40% 93.20% 25.7(25.7) 7.4

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:15.23%
  • starlord_2:21.37%
  • starlord_3:61.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.2sec 45.8sec 23.61% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.61%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
lucid dreams
starsurge Astral Power 72.8 2910.3 40.0 40.0 1718.7
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 86.12 799.63 (27.79%) 9.29 0.47 0.06%
celestial_alignment Astral Power 2.00 118.24 (4.11%) 59.12 1.76 1.47%
sunfire Astral Power 17.46 59.22 (2.06%) 3.39 0.00 0.00%
shooting_stars Astral Power 44.80 209.76 (7.29%) 4.68 0.27 0.13%
moonfire Astral Power 14.19 47.37 (1.65%) 3.34 0.00 0.00%
stellar_flare Astral Power 12.78 113.30 (3.94%) 8.87 0.04 0.04%
lunar_strike Astral Power 76.95 1020.40 (35.47%) 13.26 6.64 0.65%
lucid_dreams Astral Power 10.91 218.23 (7.59%) 20.00 0.00 0.00%
natures_balance Astral Power 400.21 199.94 (6.95%) 0.50 0.17 0.08%
arcanic_pulsar Astral Power 7.58 90.96 (3.16%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 9.60 9.71
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 24.05 0.00 75.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.1%

Statistics & Data Analysis

Fight Length
Sample Data lucid dreams Fight Length
Count 14412
Mean 299.78
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data lucid dreams Damage Per Second
Count 14412
Mean 44234.72
Minimum 39521.23
Maximum 50241.56
Spread ( max - min ) 10720.33
Range [ ( max - min ) / 2 * 100% ] 12.12%
Standard Deviation 1477.2381
5th Percentile 41905.12
95th Percentile 46745.42
( 95th Percentile - 5th Percentile ) 4840.29
Mean Distribution
Standard Deviation 12.3052
95.00% Confidence Intervall ( 44210.60 - 44258.84 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4285
0.1 Scale Factor Error with Delta=300 18629
0.05 Scale Factor Error with Delta=300 74516
0.01 Scale Factor Error with Delta=300 1862880
Priority Target DPS
Sample Data lucid dreams Priority Target Damage Per Second
Count 14412
Mean 44234.72
Minimum 39521.23
Maximum 50241.56
Spread ( max - min ) 10720.33
Range [ ( max - min ) / 2 * 100% ] 12.12%
Standard Deviation 1477.2381
5th Percentile 41905.12
95th Percentile 46745.42
( 95th Percentile - 5th Percentile ) 4840.29
Mean Distribution
Standard Deviation 12.3052
95.00% Confidence Intervall ( 44210.60 - 44258.84 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4285
0.1 Scale Factor Error with Delta=300 18629
0.05 Scale Factor Error with Delta=300 74516
0.01 Scale Factor Error with Delta=300 1862880
DPS(e)
Sample Data lucid dreams Damage Per Second (Effective)
Count 14412
Mean 44234.72
Minimum 39521.23
Maximum 50241.56
Spread ( max - min ) 10720.33
Range [ ( max - min ) / 2 * 100% ] 12.12%
Damage
Sample Data lucid dreams Damage
Count 14412
Mean 13229608.63
Minimum 10104062.01
Maximum 16284169.66
Spread ( max - min ) 6180107.65
Range [ ( max - min ) / 2 * 100% ] 23.36%
DTPS
Sample Data lucid dreams Damage Taken Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data lucid dreams Healing Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data lucid dreams Healing Per Second (Effective)
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data lucid dreams Heal
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data lucid dreams Healing Taken Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data lucid dreams Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data lucid dreamsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data lucid dreams Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
H 2.87 memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(astral_power<40|cooldown.ca_inc.remains>30)&dot.stellar_flare.remains>10&!buff.ca_inc.up
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&!buff.ca_inc.up
I 2.00 celestial_alignment,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&!buff.ca_inc.up&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 7.41 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 72.76 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.13 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.49 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 13.97 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.70 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.78 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 77.13 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 85.36 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.36 sunfire

Sample Sequence

0123456789ACDKKONPHIFGKRKRQKRQKRKRNRJKORKRQKPRQKRQRQKRQKQRNQRJKQKROQKRQPQKRRKNRQJKRMQKRQRKRQQKRNPQRJKQQRKORQKRQNQQRJKPQRKRQKRQKNORQQRRKKQPQKRQNOHGQKRQQJKRKRQKRSRKPRQKOQRQQJKRKRQKNRQRKRPOQQQKRKNRQRKRQKRFRMIEKPRQRJKRNRQKRQKRQKRQKMQRQNPQKRQQKRQKRQLROKRQQRKPQKRQKRGNHQKORQRJKQKRQKPRQRKRLQQKRQOKRQQKNRQPRKRQRKRQKORQKNRQKRQKPRLQQJKRKORQQKRQKK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask lucid dreams 58.0/100: 58% astral_power
Pre precombat 1 food lucid dreams 58.0/100: 58% astral_power
Pre precombat 2 augmentation lucid dreams 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.240 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, lucid_dreams, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.164 default O moonfire Fluffy_Pillow 7.0/100: 7% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect
0:03.065 default N sunfire Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect
0:03.964 default P stellar_flare Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect
0:04.863 default H memory_of_lucid_dreams Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect
0:05.763 default I celestial_alignment Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect
0:06.547 default F berserking Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect
0:06.547 default G use_items Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect
0:06.547 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:07.302 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:08.057 default K starsurge Fluffy_Pillow 85.0/100: 85% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:08.810 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:09.565 default Q lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:10.408 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:11.163 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.918 default Q lunar_strike Fluffy_Pillow 71.5/100: 72% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.728 default K starsurge Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.482 default R solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.235 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.990 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.746 default N sunfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.502 default R solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.256 default J cancel_buff Fluffy_Pillow 93.5/100: 94% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.256 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.011 default O moonfire Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.765 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.519 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power bloodlust, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.273 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, lucid_dreams, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.028 default Q lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.826 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.580 default P stellar_flare Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.335 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.089 default Q lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(16), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.847 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(16), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.602 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers, ignition_mages_fuse(5)
0:26.358 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(14), conch_of_dark_whispers, ignition_mages_fuse(5)
0:27.116 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(13), conch_of_dark_whispers
0:27.871 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(13), conch_of_dark_whispers
0:28.795 default K starsurge Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(12), conch_of_dark_whispers
0:29.548 default R solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers
0:30.302 default Q lunar_strike Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(10), conch_of_dark_whispers
0:31.236 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(9), conch_of_dark_whispers
0:31.989 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(9), conch_of_dark_whispers
0:33.068 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(7), conch_of_dark_whispers
0:33.821 default N sunfire Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7), conch_of_dark_whispers
0:34.673 default Q lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(6), conch_of_dark_whispers
0:35.762 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5)
0:36.517 default J cancel_buff Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(4)
0:36.517 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment, solar_empowerment, overwhelming_power(4)
0:37.457 default Q lunar_strike Fluffy_Pillow 79.5/100: 80% astral_power bloodlust, lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(3)
0:38.623 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power bloodlust, lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(2)
0:39.543 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power
0:40.306 default O moonfire Fluffy_Pillow 61.5/100: 62% astral_power bloodlust, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2)
0:41.204 default Q lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2)
0:42.693 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24)
0:43.766 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23)
0:44.656 default Q lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22)
0:45.995 default P stellar_flare Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21)
0:47.050 default Q lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19)
0:48.399 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(18)
0:49.463 default R solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(17)
0:50.372 default R solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16)
0:51.284 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(25)
0:52.323 default N sunfire Fluffy_Pillow 64.5/100: 65% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24)
0:53.229 default R solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23)
0:54.003 default Q lunar_strike Fluffy_Pillow 81.0/100: 81% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22)
0:55.167 default J cancel_buff Fluffy_Pillow 93.5/100: 94% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21)
0:55.167 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), overwhelming_power(21)
0:56.167 default R solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord, overwhelming_power(20)
0:56.994 default M moonfire Fluffy_Pillow 82.5/100: 83% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(20)
0:57.967 default Q lunar_strike Fluffy_Pillow 86.5/100: 87% astral_power lucid_dreams, arcanic_pulsar, lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(19)
0:59.398 default K starsurge Fluffy_Pillow 99.5/100: 100% astral_power lucid_dreams, arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(17)
1:00.528 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power lucid_dreams, arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(3), starlord(2), overwhelming_power(16)
1:01.465 default Q lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power lucid_dreams, arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(25)
1:02.828 default R solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(24)
1:03.739 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23)
1:04.817 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(22)
1:05.711 default Q lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(21)
1:07.052 default Q lunar_strike Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19)
1:08.403 default K starsurge Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18)
1:09.469 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(17)
1:10.377 default N sunfire Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(16)
1:11.449 default P stellar_flare Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(15)
1:12.526 default Q lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(14)
1:13.903 default R solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(13)
1:14.824 default J cancel_buff Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(12)
1:14.824 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, overwhelming_power(12)
1:16.009 default Q lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(10)
1:17.489 default Q lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(9)
1:18.970 default R solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(8)
1:19.962 default K starsurge Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(7)
1:21.134 default O moonfire Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(5), conch_of_dark_whispers
1:22.281 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(4), conch_of_dark_whispers
1:23.260 default Q lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(3), conch_of_dark_whispers
1:24.732 default K starsurge Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(2), conch_of_dark_whispers
1:25.893 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power, conch_of_dark_whispers
1:26.856 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:28.305 default N sunfire Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:29.442 default Q lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:30.890 default Q lunar_strike Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:32.339 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:33.306 default J cancel_buff Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
1:33.306 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, conch_of_dark_whispers
1:34.544 default P stellar_flare Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord, conch_of_dark_whispers
1:35.746 default Q lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord, conch_of_dark_whispers
1:37.276 default R solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord
1:38.297 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements
1:39.498 default R solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements
1:40.363 default Q lunar_strike Fluffy_Pillow 71.5/100: 72% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
1:41.657 default K starsurge Fluffy_Pillow 84.5/100: 85% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
1:42.673 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
1:43.511 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
1:44.771 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
1:45.758 default N sunfire Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
1:46.895 default O moonfire Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
1:48.030 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
1:48.997 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
1:50.444 default Q lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
1:51.892 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements
1:52.859 default R solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements
1:53.826 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(2), lunar_empowerment
1:55.064 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord
1:56.268 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2)
1:57.757 default P stellar_flare Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
1:58.924 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
2:00.414 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
2:01.583 default R solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
2:02.551 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
2:03.998 default N sunfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
2:05.135 default O moonfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
2:06.271 default H memory_of_lucid_dreams Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
2:07.407 default G use_items Fluffy_Pillow 33.5/100: 34% astral_power memory_of_lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
2:07.407 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power memory_of_lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse
2:08.794 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power memory_of_lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse
2:09.883 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse
2:10.809 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse
2:12.195 default Q lunar_strike Fluffy_Pillow 61.0/100: 61% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
2:13.524 default J cancel_buff Fluffy_Pillow 86.0/100: 86% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
2:13.524 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), solar_empowerment(2), ignition_mages_fuse(2)
2:14.661 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord, ignition_mages_fuse(2)
2:15.601 default K starsurge Fluffy_Pillow 63.0/100: 63% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, ignition_mages_fuse(3)
2:16.662 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), ignition_mages_fuse(3)
2:17.538 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), ignition_mages_fuse(3)
2:18.852 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse(3)
2:19.883 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power memory_of_lucid_dreams, lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse(4)
2:20.636 default S sunfire Fluffy_Pillow 74.5/100: 75% astral_power memory_of_lucid_dreams, lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
2:21.476 default R solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
2:22.231 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse(4)
2:23.072 default P stellar_flare Fluffy_Pillow 50.0/100: 50% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
2:23.912 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
2:24.666 default Q lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), ignition_mages_fuse(5)
2:25.697 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power lucid_dreams, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse(5)
2:26.627 default O moonfire Fluffy_Pillow 40.5/100: 41% astral_power lucid_dreams, arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
2:27.559 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3)
2:29.007 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3)
2:29.974 default Q lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:31.422 default Q lunar_strike Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:32.870 default J cancel_buff Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:32.870 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(2), solar_empowerment(2), conch_of_dark_whispers
2:34.108 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, conch_of_dark_whispers
2:35.132 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers
2:36.333 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers
2:37.326 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
2:38.814 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
2:39.981 default N sunfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:41.116 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:42.082 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:43.529 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:44.495 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:45.633 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
2:46.600 default P stellar_flare Fluffy_Pillow 36.0/100: 36% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
2:47.736 default O moonfire Fluffy_Pillow 44.5/100: 45% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
2:48.874 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
2:50.321 default Q lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:51.768 default Q lunar_strike Fluffy_Pillow 74.5/100: 75% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
2:53.214 default K starsurge Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(6), solar_empowerment(2)
2:54.452 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord
2:55.475 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord
2:56.676 default N sunfire Fluffy_Pillow 41.5/100: 42% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2)
2:57.845 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2)
2:58.837 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
3:00.327 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements
3:01.320 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
3:02.490 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
3:03.332 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
3:04.590 default K starsurge Fluffy_Pillow 74.0/100: 74% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
3:05.579 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
3:06.419 default F berserking Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24)
3:06.547 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24)
3:07.302 default M moonfire Fluffy_Pillow 51.5/100: 52% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23)
3:08.131 default I celestial_alignment Fluffy_Pillow 55.0/100: 55% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22)
3:08.960 default E potion Fluffy_Pillow 95.5/100: 96% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22)
3:08.960 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), battle_potion_of_intellect
3:09.790 default P stellar_flare Fluffy_Pillow 56.5/100: 56% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), battle_potion_of_intellect
3:10.623 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), battle_potion_of_intellect
3:11.378 default Q lunar_strike Fluffy_Pillow 73.5/100: 74% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), battle_potion_of_intellect
3:12.447 default R solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18), battle_potion_of_intellect
3:13.200 default J cancel_buff Fluffy_Pillow 98.5/100: 99% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), battle_potion_of_intellect
3:13.200 default K starsurge Fluffy_Pillow 98.5/100: 99% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), torrent_of_elements, overwhelming_power(17), battle_potion_of_intellect
3:14.123 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(16), battle_potion_of_intellect
3:14.888 default N sunfire Fluffy_Pillow 67.5/100: 68% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(16), battle_potion_of_intellect
3:15.785 default R solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(15), battle_potion_of_intellect
3:16.686 default Q lunar_strike Fluffy_Pillow 84.0/100: 84% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(14), battle_potion_of_intellect
3:17.837 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(13), battle_potion_of_intellect
3:18.745 default R solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(12), battle_potion_of_intellect
3:19.571 default Q lunar_strike Fluffy_Pillow 86.0/100: 86% astral_power lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(11), battle_potion_of_intellect
3:20.816 default K starsurge Fluffy_Pillow 98.5/100: 99% astral_power lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(10), battle_potion_of_intellect
3:21.795 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(9), battle_potion_of_intellect
3:22.609 default Q lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(8), battle_potion_of_intellect
3:23.830 default K starsurge Fluffy_Pillow 80.5/100: 81% astral_power lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(7), battle_potion_of_intellect
3:24.793 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(6), battle_potion_of_intellect
3:25.615 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(5), battle_potion_of_intellect
3:26.852 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(4), battle_potion_of_intellect
3:27.827 default M moonfire Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(3), battle_potion_of_intellect
3:28.806 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(2), battle_potion_of_intellect
3:30.246 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:31.213 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:32.659 default N sunfire Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:33.795 default P stellar_flare Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), battle_potion_of_intellect
3:35.034 default Q lunar_strike Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2)
3:36.611 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2)
3:37.848 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord
3:38.868 default Q lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord
3:40.400 default Q lunar_strike Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord
3:41.931 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord
3:43.133 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2)
3:43.997 default Q lunar_strike Fluffy_Pillow 76.0/100: 76% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2)
3:45.291 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2)
3:46.309 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3)
3:47.148 default Q lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:48.408 default L sunfire Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3)
3:49.395 default R solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord(3)
3:50.361 default O moonfire Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:51.499 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
3:52.637 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(3), starlord(3), torrent_of_elements
3:53.603 default Q lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
3:55.050 default Q lunar_strike Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
3:56.498 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
3:57.463 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, torrent_of_elements
3:58.702 default P stellar_flare Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements
3:59.905 default Q lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements
4:01.437 default K starsurge Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements
4:02.639 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements
4:03.633 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
4:05.121 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
4:06.288 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
4:07.256 default G use_items Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:07.256 default N sunfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse
4:08.344 default H memory_of_lucid_dreams Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse
4:09.433 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power memory_of_lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse
4:10.821 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power memory_of_lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse
4:11.909 default O moonfire Fluffy_Pillow 31.5/100: 32% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse(2)
4:12.954 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse(2)
4:13.843 default Q lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
4:15.175 default R solar_wrath Fluffy_Pillow 80.0/100: 80% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
4:16.063 default J cancel_buff Fluffy_Pillow 96.5/100: 97% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse(3)
4:16.063 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, ignition_mages_fuse(3)
4:17.156 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord, ignition_mages_fuse(3)
4:18.509 default K starsurge Fluffy_Pillow 82.0/100: 82% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord, ignition_mages_fuse(3)
4:19.572 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(3), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(4)
4:20.417 default Q lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.682 default K starsurge Fluffy_Pillow 84.0/100: 84% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(4)
4:22.677 default P stellar_flare Fluffy_Pillow 57.0/100: 57% astral_power memory_of_lucid_dreams, celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:23.518 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
4:24.271 default Q lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
4:25.300 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
4:26.055 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
4:26.866 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
4:27.620 default L sunfire Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:28.608 default Q lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:30.056 default Q lunar_strike Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:31.503 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:32.640 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
4:33.606 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
4:35.052 default O moonfire Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
4:36.188 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), torrent_of_elements
4:37.426 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord, torrent_of_elements
4:38.448 default Q lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord, torrent_of_elements
4:39.979 default Q lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements
4:41.511 default K starsurge Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements
4:42.712 default N sunfire Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements
4:43.881 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements
4:44.873 default Q lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
4:46.362 default P stellar_flare Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements
4:47.532 default R solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2)
4:48.525 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2)
4:49.693 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3)
4:50.660 default Q lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:52.108 default R solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3)
4:53.075 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
4:54.210 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3)
4:55.176 default Q lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25)
4:56.499 default K starsurge Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), overwhelming_power(24)
4:57.634 default O moonfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord, overwhelming_power(23)
4:58.741 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord, overwhelming_power(22)
4:59.685 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(21)
5:01.106 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(19)
5:02.228 default N sunfire Fluffy_Pillow 43.0/100: 43% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(18)
5:03.323 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(17)
5:04.257 default Q lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16)
5:05.659 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(15)
5:06.766 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(14)
5:07.565 default Q lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(13)
5:08.764 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power lucid_dreams, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12)
5:09.712 default P stellar_flare Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(11)
5:10.661 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(10)
5:11.473 default L sunfire Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(9)
5:12.430 default Q lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(8)
5:13.836 default Q lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7)
5:15.246 default J cancel_buff Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar, solar_empowerment(3), starlord(3), overwhelming_power(5)
5:15.246 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar, solar_empowerment(3), overwhelming_power(5)
5:16.463 default R solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power lucid_dreams, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(4)
5:17.472 default K starsurge Fluffy_Pillow 79.5/100: 80% astral_power lucid_dreams, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(3)
5:18.660 default O moonfire Fluffy_Pillow 40.0/100: 40% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(2)
5:19.820 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power
5:20.811 default Q lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2)
5:22.299 default Q lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
5:23.788 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2)
5:24.957 default R solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
5:25.924 default Q lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
5:27.371 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
5:28.507 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="lucid dreams"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(astral_power<40|cooldown.ca_inc.remains>30)&dot.stellar_flare.remains>10&!buff.ca_inc.up
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&!buff.ca_inc.up
actions+=/celestial_alignment,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&!buff.ca_inc.up&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

purification protocol : 42099 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
42099.1 42099.1 22.0 / 0.052% 5208.3 / 12.4% 5167.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 8.0 Astral Power 0.00% 58.4 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
purification protocol 42099
Heed My Call 301 (430) 0.7% (1.0%) 8.2 33.48sec 15769 0 Direct 8.2 9129 18257 11041 20.9%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.17 8.17 0.00 0.00 0.0000 0.0000 90216.21 90216.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.46 79.06% 9128.87 8921 9813 9124.49 0 9813 58971 58971 0.00
crit 1.71 20.94% 18257.42 17842 19626 15117.91 0 19626 31245 31245 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 129 0.3% 8.2 33.48sec 4729 0 Direct 8.2 3912 7824 4729 20.9%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.17 8.17 0.00 0.00 0.0000 0.0000 38639.45 38639.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.47 79.13% 3912.48 3823 4206 3911.43 0 4206 25298 25298 0.00
crit 1.71 20.87% 7823.84 7646 8411 6454.10 0 8411 13341 13341 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5886 14.0% 76.8 3.80sec 22955 17687 Direct 76.8 18997 38551 22955 20.2%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.78 76.78 0.00 0.00 1.2979 0.0000 1762503.25 1762503.25 0.00 17686.76 17686.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.24 79.76% 18997.49 10135 24211 19004.31 18294 20034 1163429 1163429 0.00
crit 15.54 20.24% 38551.41 20270 48422 38580.15 35276 43531 599074 599074 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2913 6.9% 14.0 21.37sec 62081 61401 Direct 14.0 3269 6646 3959 20.4%  
Periodic 222.9 3008 6135 3662 20.9% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.04 14.04 222.86 222.86 1.0111 1.3310 871776.77 871776.77 0.00 2804.72 61401.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.17 79.57% 3269.46 2981 4065 3271.09 2981 3753 36531 36531 0.00
crit 2.87 20.43% 6645.95 5963 8130 6385.36 0 8130 19067 19067 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 176.3 79.09% 3008.49 2 3785 3009.73 2922 3156 530282 530282 0.00
crit 46.6 20.91% 6135.47 21 7570 6139.46 5778 6650 285896 285896 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Purification Protocol 755 1.8% 16.6 17.36sec 13578 0 Direct 16.6 11227 22450 13578 21.0%  

Stats details: purification_protocol

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.64 16.64 0.00 0.00 0.0000 0.0000 225966.51 225966.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.15 79.05% 11226.70 10972 12069 11226.80 10972 12069 147681 147681 0.00
crit 3.49 20.95% 22450.05 21944 24139 21792.80 0 24139 78285 78285 0.00
 
 

Action details: purification_protocol

Static Values
  • id:295293
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295293
  • name:Purification Protocol
  • school:physical
  • tooltip:
  • description:MOTHER has added a Purification Protocol to your Heart of Azeroth, allowing your damaging spells and abilities to release a blast of Azerite energy at your target, dealing ${{$s1=1920}*(1+$@versadmg)} Fire damage to any enemy within $295305A2 yds$?a295363[, and heals you for ${{$295293s4=869}*(1+$@versadmg)} every $295310t1 sec for {$295310d=8 seconds}][]. Purification Protocol deals {$s2=50}% additional damage against Aberrations.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9969.52
  • base_dd_max:9969.52
  • base_dd_mult:1.00
 
Purifying Blast 0 (834) 0.0% (2.0%) 5.5 60.37sec 45604 39990

Stats details: purifying_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 0.00 0.00 0.00 1.1405 0.0000 0.00 0.00 0.00 39990.30 39990.30
 
 

Action details: purifying_blast

Static Values
  • id:295337
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295337
  • name:Purifying Blast
  • school:physical
  • tooltip:
  • description:Call down a purifying beam upon the target area, dealing ${{$295293s3=1173}*(1+$@versadmg)*{$s2=7}} Fire damage over {$d=6 seconds}.$?a295364[ Has a low chance to immediately annihilate any specimen deemed unworthy by MOTHER.][]$?a295352[ When an enemy dies within the beam, your damage is increased by {$295354s1=10}% for {$295354d=8 seconds}.][] Any Aberration struck by the beam is stunned for {$295366d=3 seconds}.
 
    Purification Protocol (purifying_tick) 834 2.0% 37.9 7.63sec 6576 0 Periodic 37.9 5476 10946 6576 20.1% 0.0%

Stats details: purifying_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.93 0.00 0.00 37.93 0.0000 0.0000 249419.51 249419.51 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.3 79.89% 5475.73 5364 5900 5475.47 5364 5821 165920 165920 0.00
crit 7.6 20.11% 10946.14 10728 11801 10942.74 0 11801 83500 83500 0.00
 
 

Action details: purifying_tick

Static Values
  • id:295293
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295293
  • name:Purification Protocol
  • school:physical
  • tooltip:
  • description:MOTHER has added a Purification Protocol to your Heart of Azeroth, allowing your damaging spells and abilities to release a blast of Azerite energy at your target, dealing ${{$s1=1920}*(1+$@versadmg)} Fire damage to any enemy within $295305A2 yds$?a295363[, and heals you for ${{$295293s4=869}*(1+$@versadmg)} every $295310t1 sec for {$295310d=8 seconds}][]. Purification Protocol deals {$s2=50}% additional damage against Aberrations.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4873.57
  • base_dd_max:4873.57
  • base_dd_mult:1.00
 
Shooting Stars 935 2.2% 44.4 6.54sec 6295 0 Direct 44.4 5172 10545 6295 20.9%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.44 44.44 0.00 0.00 0.0000 0.0000 279780.06 279780.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.15 79.10% 5171.79 4769 6503 5173.61 4850 5665 181808 181808 0.00
crit 9.29 20.90% 10545.47 9539 13006 10548.96 0 13006 97972 97972 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3268 (5234) 7.8% (12.4%) 92.3 3.18sec 16969 18953 Direct 92.9 8663 17657 10537 20.8%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.34 92.86 0.00 0.00 0.8953 0.0000 978400.86 978400.86 0.00 18952.86 18952.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.51 79.17% 8663.14 7949 10838 8667.76 8381 9132 636863 636863 0.00
crit 19.34 20.83% 17657.21 15898 21676 17674.20 16133 20045 341538 341538 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1966 4.7% 73.9 3.96sec 7962 0 Direct 73.9 7962 0 7962 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.91 73.91 0.00 0.00 0.0000 0.0000 588507.63 588507.63 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.91 100.00% 7962.20 5962 16257 7968.94 6872 9909 588508 588508 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 13836 32.9% 60.9 4.95sec 67966 65195 Direct 60.7 55703 113956 68183 21.4%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.92 60.72 0.00 0.00 1.0425 0.0000 4140233.43 4140233.43 0.00 65195.39 65195.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.71 78.57% 55703.25 51347 69612 55721.86 53459 58561 2657694 2657694 0.00
crit 13.01 21.43% 113955.55 102695 139223 114065.51 102695 133014 1482539 1482539 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1891 4.5% 12.7 23.57sec 44402 43298 Direct 12.7 2751 5608 3390 22.4%  
Periodic 220.4 1950 3974 2372 20.9% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.75 12.75 220.37 220.37 1.0255 1.3345 565944.61 565944.61 0.00 1842.50 43297.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.89 77.62% 2750.67 2570 3504 2750.39 2570 3043 27213 27213 0.00
crit 2.85 22.38% 5607.51 5140 7009 5389.69 0 7009 15996 15996 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 174.4 79.15% 1949.88 6 2453 1950.68 1896 2031 340092 340092 0.00
crit 46.0 20.85% 3974.29 38 4906 3976.92 3755 4342 182644 182644 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6145 14.5% 89.7 3.09sec 20382 0 Direct 89.7 16391 32751 20382 24.4%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.73 89.73 0.00 0.00 0.0000 0.0000 1828814.70 1828814.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.84 75.60% 16390.99 16021 17623 16391.05 16021 17369 1111887 1111887 0.00
crit 21.89 24.40% 32750.71 32042 35246 32748.21 32042 35100 716927 716927 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3241 7.7% 18.0 16.53sec 53773 52869 Direct 18.0 4497 9058 5383 19.4%  
Periodic 222.0 3232 6589 3933 20.9% 98.7%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.04 18.04 221.98 221.98 1.0171 1.3323 970150.95 970150.95 0.00 3088.78 52869.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.54 80.58% 4497.44 4112 5607 4497.74 4158 4827 65382 65382 0.00
crit 3.50 19.42% 9058.40 8225 11214 8866.98 0 11214 31740 31740 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 175.6 79.11% 3231.72 2 4065 3233.05 3144 3363 567552 567552 0.00
crit 46.4 20.89% 6588.66 4 8130 6592.86 6207 7205 305476 305476 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
purification protocol
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.55sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.65sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9029 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 53.6 44.3sec 5.0sec 92.81% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.55%
  • arcanic_pulsar_2:10.36%
  • arcanic_pulsar_3:10.96%
  • arcanic_pulsar_4:10.71%
  • arcanic_pulsar_5:13.81%
  • arcanic_pulsar_6:10.61%
  • arcanic_pulsar_7:10.78%
  • arcanic_pulsar_8:14.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 188.6sec 0.0sec 16.23% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.12% 7.65% 0.0(0.0) 2.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.5sec 37.5sec 25.84% 32.60% 0.0(0.0) 8.1

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.9sec 45.5sec 23.60% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.17% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.89%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.2 45.5 8.9sec 3.8sec 81.75% 99.68% 1.8(1.8) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.45%
  • lunar_empowerment_2:31.49%
  • lunar_empowerment_3:13.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 399.2(399.2) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.5 64.4sec 33.8sec 48.07% 0.00% 3.5(48.5) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.04%
  • overwhelming_power_16:2.11%
  • overwhelming_power_17:2.17%
  • overwhelming_power_18:2.23%
  • overwhelming_power_19:2.30%
  • overwhelming_power_20:2.37%
  • overwhelming_power_21:2.44%
  • overwhelming_power_22:2.52%
  • overwhelming_power_23:2.60%
  • overwhelming_power_24:2.67%
  • overwhelming_power_25:1.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 24.5 51.7 12.1sec 3.9sec 85.52% 79.71% 0.3(0.3) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.05%
  • solar_empowerment_2:39.58%
  • solar_empowerment_3:17.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.7 20.3sec 4.9sec 97.06% 92.08% 15.8(15.8) 11.3

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.82%
  • starlord_2:22.31%
  • starlord_3:59.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 61.1sec 45.8sec 23.62% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.62%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
purification protocol
starsurge Astral Power 60.9 2436.6 40.0 40.0 1699.2
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 93.34 746.67 (31.12%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.33%) 40.00 0.00 0.00%
sunfire Astral Power 18.04 54.12 (2.26%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.44 177.77 (7.41%) 4.00 0.01 0.00%
moonfire Astral Power 14.04 42.13 (1.76%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.75 101.97 (4.25%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.78 921.32 (38.40%) 12.00 0.05 0.01%
natures_balance Astral Power 400.21 200.10 (8.34%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.25 74.95 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.00 8.13
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.77 0.00 85.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data purification protocol Fight Length
Count 14412
Mean 299.78
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data purification protocol Damage Per Second
Count 14412
Mean 42099.14
Minimum 37840.20
Maximum 47337.59
Spread ( max - min ) 9497.38
Range [ ( max - min ) / 2 * 100% ] 11.28%
Standard Deviation 1349.8728
5th Percentile 39974.94
95th Percentile 44402.67
( 95th Percentile - 5th Percentile ) 4427.73
Mean Distribution
Standard Deviation 11.2443
95.00% Confidence Intervall ( 42077.10 - 42121.18 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3950
0.1 Scale Factor Error with Delta=300 15555
0.05 Scale Factor Error with Delta=300 62220
0.01 Scale Factor Error with Delta=300 1555498
Priority Target DPS
Sample Data purification protocol Priority Target Damage Per Second
Count 14412
Mean 42099.14
Minimum 37840.20
Maximum 47337.59
Spread ( max - min ) 9497.38
Range [ ( max - min ) / 2 * 100% ] 11.28%
Standard Deviation 1349.8728
5th Percentile 39974.94
95th Percentile 44402.67
( 95th Percentile - 5th Percentile ) 4427.73
Mean Distribution
Standard Deviation 11.2443
95.00% Confidence Intervall ( 42077.10 - 42121.18 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3950
0.1 Scale Factor Error with Delta=300 15555
0.05 Scale Factor Error with Delta=300 62220
0.01 Scale Factor Error with Delta=300 1555498
DPS(e)
Sample Data purification protocol Damage Per Second (Effective)
Count 14412
Mean 42099.14
Minimum 37840.20
Maximum 47337.59
Spread ( max - min ) 9497.38
Range [ ( max - min ) / 2 * 100% ] 11.28%
Damage
Sample Data purification protocol Damage
Count 14412
Mean 12590353.94
Minimum 9669495.59
Maximum 15646724.23
Spread ( max - min ) 5977228.65
Range [ ( max - min ) / 2 * 100% ] 23.74%
DTPS
Sample Data purification protocol Damage Taken Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data purification protocol Healing Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data purification protocol Healing Per Second (Effective)
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data purification protocol Heal
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data purification protocol Healing Taken Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data purification protocol Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data purification protocolTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data purification protocol Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
H 5.47 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.91 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.92 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.99 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.80 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.59 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.24 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.75 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 77.14 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 92.59 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.45 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRKRQRKRQRQKRQNRORQRQKPKRLQKQQRRRRRRKRKRQRQRMKNQPQKRQQKRQRQJKHNORKRQRKPRQQQJKNRKRQKRQKORQQPRRNKQKQRQKORQRRKQRNRQKPHQRKGQRORKRQRQRLRRKKQPRKRQQKONRQQRRRKKQQKPRQNRKOQRRRRRKHKRQFRLIEKRPRQKRORQRSRJKRQKRQKRLQKQQQPRORRKKRQKRQLQRQKRQQRROJKKHPNQGQKRQRKQQRRRQRKOKNPQRKRQRKRLQQRRRRKKOQPQRKNRQKRQRQRQHKOKRQNPQRKRQQQRJKRKRKRLQQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask purification protocol 58.0/100: 58% astral_power
Pre precombat 1 food purification protocol 58.0/100: 58% astral_power
Pre precombat 2 augmentation purification protocol 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H purifying_blast Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.239 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, overwhelming_power(25), battle_potion_of_intellect
0:02.110 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), battle_potion_of_intellect
0:02.960 default N sunfire Fluffy_Pillow 30.5/100: 31% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), battle_potion_of_intellect
0:03.811 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(23), battle_potion_of_intellect
0:04.665 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(25), battle_potion_of_intellect
0:05.419 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), battle_potion_of_intellect
0:05.419 default G use_items Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), battle_potion_of_intellect
0:05.419 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse
0:06.173 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse
0:06.928 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse
0:07.682 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse
0:08.435 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse
0:09.221 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse
0:09.974 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.727 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.481 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.241 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.996 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.761 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.517 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.272 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.028 default N sunfire Fluffy_Pillow 30.5/100: 31% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(13), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.783 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(13), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.538 default O moonfire Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(12), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.290 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(11), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.043 default Q lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.841 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.595 default Q lunar_strike Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(9), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.397 default K starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, torrent_of_elements, overwhelming_power(8), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.152 default P stellar_flare Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(7), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.908 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(7), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.660 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(6), ignition_mages_fuse(5)
0:24.413 default L sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(5), ignition_mages_fuse(5)
0:25.166 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(4), ignition_mages_fuse(5)
0:26.093 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(3)
0:26.982 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(3)
0:28.085 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power
0:29.195 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3)
0:29.950 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3)
0:30.705 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:31.579 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:32.454 default R solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:33.330 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:34.205 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:35.083 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
0:35.838 default K starsurge Fluffy_Pillow 72.5/100: 73% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3)
0:36.600 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
0:37.354 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3)
0:38.324 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3)
0:39.086 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3)
0:40.055 default R solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3)
0:40.817 default M moonfire Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3)
0:41.579 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar, lunar_empowerment(2), conch_of_dark_whispers
0:42.816 default N sunfire Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord, conch_of_dark_whispers
0:44.019 default Q lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord, conch_of_dark_whispers
0:45.551 default P stellar_flare Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord, conch_of_dark_whispers
0:46.753 default Q lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord, conch_of_dark_whispers
0:48.284 default K starsurge Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers
0:49.486 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), conch_of_dark_whispers
0:50.480 default Q lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers
0:51.967 default Q lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
0:53.456 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), conch_of_dark_whispers
0:54.622 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
0:55.588 default Q lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:57.035 default R solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3)
0:58.000 default Q lunar_strike Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
0:59.448 default J cancel_buff Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3)
0:59.448 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(4), solar_empowerment(2)
1:00.686 default H purifying_blast Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord
1:01.890 default N sunfire Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord
1:03.092 default O moonfire Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord
1:04.295 default R solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord
1:05.318 default K starsurge Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord
1:06.520 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2)
1:07.514 default Q lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:09.001 default R solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2)
1:09.995 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2)
1:11.165 default P stellar_flare Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:12.303 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:13.270 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(3)
1:14.717 default Q lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:16.165 default Q lunar_strike Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
1:17.612 default J cancel_buff Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
1:17.612 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(7), solar_empowerment(2)
1:18.851 default N sunfire Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord
1:20.052 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord
1:21.076 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord
1:22.279 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2)
1:23.143 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
1:24.436 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
1:25.453 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
1:26.292 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
1:27.550 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
1:28.540 default O moonfire Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
1:29.678 default R solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
1:30.645 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
1:32.093 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
1:33.540 default P stellar_flare Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements
1:34.674 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements
1:35.642 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements
1:36.608 default N sunfire Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), torrent_of_elements
1:37.745 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(2), lunar_empowerment
1:38.985 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(25)
1:40.387 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(23)
1:41.495 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(22)
1:42.869 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(21)
1:43.792 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(20)
1:45.178 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(18)
1:46.273 default O moonfire Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(17)
1:47.343 default R solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(16)
1:48.256 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15)
1:49.628 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14)
1:50.545 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(13)
1:51.466 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, overwhelming_power(12)
1:52.551 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(11)
1:53.942 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(10)
1:54.875 default N sunfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(9)
1:55.972 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(8)
1:57.075 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(6)
1:58.490 default K starsurge Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(6), torrent_of_elements, overwhelming_power(5)
1:59.704 default P stellar_flare Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(4)
2:00.888 default H purifying_blast Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(3)
2:02.078 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power
2:03.602 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(7), solar_empowerment, starlord, torrent_of_elements
2:04.626 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(7), starlord, torrent_of_elements
2:05.829 default G use_items Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements
2:05.829 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, ignition_mages_fuse
2:07.254 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), torrent_of_elements, ignition_mages_fuse
2:08.205 default O moonfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(8), starlord(2), torrent_of_elements, ignition_mages_fuse
2:09.324 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), starlord(2), torrent_of_elements, ignition_mages_fuse
2:10.443 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), starlord(2), torrent_of_elements, ignition_mages_fuse(2)
2:11.516 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(2)
2:12.289 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(2)
2:13.447 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(2)
2:14.220 default Q lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power celestial_alignment, starlord(3), torrent_of_elements, ignition_mages_fuse(3)
2:15.527 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power celestial_alignment, starlord(3), torrent_of_elements, ignition_mages_fuse(3)
2:16.401 default L sunfire Fluffy_Pillow 73.5/100: 74% astral_power celestial_alignment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.274 default R solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
2:18.278 default R solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.245 default K starsurge Fluffy_Pillow 98.5/100: 99% astral_power conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.296 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, ignition_mages_fuse(4)
2:21.319 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(4)
2:22.583 default P stellar_flare Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(5)
2:23.541 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.355 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(5)
2:25.314 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
2:26.105 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:27.551 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:28.998 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:30.135 default O moonfire Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:31.273 default N sunfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:32.410 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3)
2:33.375 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:34.822 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
2:36.269 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3)
2:37.235 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3)
2:38.202 default R solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(4), starlord(3)
2:39.339 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(4)
2:40.579 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord
2:41.781 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:43.269 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2)
2:44.759 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2)
2:45.928 default P stellar_flare Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3)
2:47.062 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3)
2:48.029 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
2:49.475 default N sunfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
2:50.612 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
2:51.578 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
2:52.715 default O moonfire Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
2:53.852 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
2:55.300 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(25)
2:56.183 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(24)
2:57.069 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(23)
2:57.959 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(23)
2:59.005 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(21)
3:00.057 default K starsurge Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(8), overwhelming_power(20)
3:01.209 default H purifying_blast Fluffy_Pillow 42.5/100: 43% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(19)
3:02.186 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18)
3:03.166 default R solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(17)
3:03.978 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(17)
3:05.191 default F berserking Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(15)
3:05.419 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(15)
3:06.175 default L sunfire Fluffy_Pillow 38.0/100: 38% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(14)
3:07.054 default I celestial_alignment Fluffy_Pillow 41.5/100: 42% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(13)
3:07.934 default E potion Fluffy_Pillow 82.0/100: 82% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(25), conch_of_dark_whispers
3:07.934 default K starsurge Fluffy_Pillow 82.0/100: 82% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(25), conch_of_dark_whispers, battle_potion_of_intellect
3:08.779 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect
3:09.534 default P stellar_flare Fluffy_Pillow 51.0/100: 51% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect
3:10.363 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect
3:11.117 default Q lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect
3:12.180 default K starsurge Fluffy_Pillow 81.0/100: 81% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect
3:13.018 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect
3:13.772 default O moonfire Fluffy_Pillow 50.0/100: 50% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect
3:14.612 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect
3:15.456 default Q lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers, battle_potion_of_intellect
3:16.532 default R solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers, battle_potion_of_intellect
3:17.285 default S sunfire Fluffy_Pillow 83.5/100: 84% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers, battle_potion_of_intellect
3:18.137 default R solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers, battle_potion_of_intellect
3:19.075 default J cancel_buff Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers, battle_potion_of_intellect
3:19.075 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers, battle_potion_of_intellect
3:20.103 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(12), conch_of_dark_whispers, battle_potion_of_intellect
3:20.956 default Q lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(12), conch_of_dark_whispers, battle_potion_of_intellect
3:22.229 default K starsurge Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers, battle_potion_of_intellect
3:23.184 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect
3:23.977 default Q lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect
3:25.165 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect
3:26.105 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect
3:26.884 default L sunfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect
3:27.804 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(6), lunar_empowerment(3), starlord(3), overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect
3:29.152 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(6), lunar_empowerment(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect
3:30.215 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(17), conch_of_dark_whispers, battle_potion_of_intellect
3:31.576 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), conch_of_dark_whispers, battle_potion_of_intellect
3:32.941 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers
3:34.312 default P stellar_flare Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(13), conch_of_dark_whispers
3:35.396 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(12), conch_of_dark_whispers
3:36.320 default O moonfire Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(11)
3:37.411 default R solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(10)
3:38.342 default R solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(9)
3:39.443 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(7), overwhelming_power(8)
3:40.646 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(7)
3:41.817 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(6)
3:42.664 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(5)
3:43.936 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(4)
3:44.936 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(3)
3:45.766 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(2)
3:47.015 default L sunfire Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25)
3:47.921 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25)
3:49.246 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23)
3:50.136 default Q lunar_strike Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22)
3:51.474 default K starsurge Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21)
3:52.527 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20)
3:53.426 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19)
3:54.778 default Q lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18)
3:56.134 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(16)
3:57.047 default R solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(15)
3:57.963 default O moonfire Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(15)
3:59.041 default J cancel_buff Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(13)
3:59.041 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(2), overwhelming_power(13)
4:00.222 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(12)
4:01.372 default H purifying_blast Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(11)
4:02.494 default P stellar_flare Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(10)
4:03.620 default N sunfire Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(9), conch_of_dark_whispers
4:04.751 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(8), conch_of_dark_whispers
4:06.194 default G use_items Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(6), conch_of_dark_whispers
4:06.194 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(6), conch_of_dark_whispers, ignition_mages_fuse
4:07.589 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(5), conch_of_dark_whispers, ignition_mages_fuse
4:08.690 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(4), conch_of_dark_whispers, ignition_mages_fuse
4:09.603 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(3), conch_of_dark_whispers, ignition_mages_fuse
4:10.974 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(25), conch_of_dark_whispers, ignition_mages_fuse(2)
4:11.791 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24), conch_of_dark_whispers, ignition_mages_fuse(2)
4:12.756 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers, ignition_mages_fuse(2)
4:13.987 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers, ignition_mages_fuse(2)
4:15.223 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), overwhelming_power(20), conch_of_dark_whispers, ignition_mages_fuse(3)
4:16.023 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse(3)
4:16.828 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.632 default Q lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), overwhelming_power(18), conch_of_dark_whispers, ignition_mages_fuse(3)
4:18.839 default R solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse(4)
4:19.756 default K starsurge Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(6), overwhelming_power(16), conch_of_dark_whispers, ignition_mages_fuse(4)
4:20.756 default O moonfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(15), ignition_mages_fuse(4)
4:21.731 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14), ignition_mages_fuse(4)
4:22.707 default N sunfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(13), ignition_mages_fuse(5)
4:23.628 default P stellar_flare Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(12), ignition_mages_fuse(5)
4:24.552 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(11), ignition_mages_fuse(5)
4:25.730 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(10), ignition_mages_fuse(5)
4:26.518 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(9)
4:27.647 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(8)
4:28.463 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7)
4:29.690 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(6)
4:30.514 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(5)
4:31.486 default R solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(4)
4:32.315 default L sunfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(3)
4:33.292 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(2)
4:34.729 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power
4:36.171 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, solar_empowerment, starlord(3)
4:37.136 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, starlord(3)
4:38.273 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar, starlord(3)
4:39.409 default R solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar, starlord(3)
4:40.547 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar, lunar_empowerment
4:41.785 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord
4:42.988 default O moonfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2)
4:44.158 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2)
4:45.647 default P stellar_flare Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
4:46.816 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
4:48.304 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2)
4:49.297 default K starsurge Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2)
4:50.467 default N sunfire Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
4:51.605 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
4:52.572 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:54.018 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24)
4:55.061 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24)
4:55.946 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24)
4:57.275 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(22)
4:58.169 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21)
4:59.510 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(20)
5:00.411 default Q lunar_strike Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(19)
5:01.763 default H purifying_blast Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(5), solar_empowerment, overwhelming_power(18)
5:02.922 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(5), solar_empowerment, overwhelming_power(17)
5:04.086 default O moonfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(15)
5:05.226 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(14)
5:06.370 default R solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(13)
5:07.317 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(12)
5:08.742 default N sunfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(11)
5:09.864 default P stellar_flare Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(10)
5:10.991 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(9)
5:12.433 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(7)
5:13.401 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(6)
5:14.545 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(5)
5:15.494 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(4)
5:16.920 default Q lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(3)
5:18.353 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power
5:19.796 default R solar_wrath Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3)
5:20.763 default J cancel_buff Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3)
5:20.763 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(8), solar_empowerment
5:22.001 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord
5:22.892 default K starsurge Fluffy_Pillow 70.0/100: 70% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord
5:23.939 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2)
5:24.804 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
5:25.821 default R solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3)
5:26.660 default L sunfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
5:27.649 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3)
5:29.096 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="purification protocol"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

ripple in space : 41814 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
41813.8 41813.8 22.4 / 0.054% 5320.0 / 12.7% 5132.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 8.0 Astral Power 0.00% 58.4 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ripple in space 41814
Heed My Call 304 (434) 0.7% (1.0%) 8.2 33.04sec 15779 0 Direct 8.2 9131 18243 11046 21.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.24 8.24 0.00 0.00 0.0000 0.0000 91054.81 91054.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.51 78.99% 9130.63 8921 9813 9126.65 0 9813 59452 59452 0.00
crit 1.73 21.01% 18242.62 17842 19626 15105.00 0 19626 31603 31603 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 130 0.3% 8.2 33.04sec 4733 0 Direct 8.2 3912 7823 4733 21.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.24 8.24 0.00 0.00 0.0000 0.0000 39018.45 39018.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.51 79.01% 3912.44 3823 4206 3911.31 0 4206 25484 25484 0.00
crit 1.73 20.99% 7823.40 7646 8411 6518.66 0 8411 13534 13534 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6032 14.4% 76.7 3.81sec 23548 18144 Direct 76.7 19451 39655 23548 20.3%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.70 76.70 0.00 0.00 1.2978 0.0000 1806124.80 1806124.80 0.00 18143.80 18143.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.15 79.72% 19450.60 10135 25776 19458.50 18680 20634 1189337 1189337 0.00
crit 15.55 20.28% 39655.19 20270 51553 39692.17 35246 47543 616788 616788 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2991 7.2% 14.0 21.37sec 63771 63057 Direct 14.0 3365 6869 4077 20.3%  
Periodic 222.8 3085 6324 3760 20.8% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.04 14.04 222.85 222.85 1.0114 1.3309 895091.40 895091.40 0.00 2880.01 63056.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.18 79.68% 3364.60 2981 4328 3365.93 3046 3786 37630 37630 0.00
crit 2.85 20.32% 6869.18 5963 8656 6615.90 0 8656 19590 19590 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 176.4 79.17% 3085.14 2 4030 3086.48 2999 3234 544302 544302 0.00
crit 46.4 20.83% 6323.96 4 8059 6328.80 5926 6915 293569 293569 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Ripple in Space 420 1.0% 5.5 60.37sec 22941 20107 Direct 5.4 23093 0 23093 0.0%  

Stats details: ripple_in_space

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 5.44 0.00 0.00 1.1410 0.0000 125510.90 125510.90 0.00 20107.48 20107.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.44 100.00% 23092.59 22641 24905 23091.61 22641 24528 125511 125511 0.00
 
 

Action details: ripple_in_space

Static Values
  • id:302731
  • school:fire
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:302731
  • name:Ripple in Space
  • school:physical
  • tooltip:About to relocate with Ripple in Space.
  • description:Create an Azerite beacon at a target location. After {$d=4 seconds}, the Heart of Azeroth will relocate you to this beacon and deal {$s2=4952} Fire damage to all nearby enemies.$?a302780[ For {$302864d=10 seconds} after being relocated, you take {$302864s1=10}% reduced damage.][]
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:20572.62
  • base_dd_max:20572.62
  • base_dd_mult:1.00
 
Shooting Stars 961 2.3% 44.5 6.56sec 6468 0 Direct 44.5 5304 10869 6468 20.9%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.48 44.48 0.00 0.00 0.0000 0.0000 287713.19 287713.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.18 79.09% 5303.77 4769 6923 5306.04 4925 5825 186589 186589 0.00
crit 9.30 20.91% 10869.36 9539 13847 10872.96 0 13847 101124 101124 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3369 (5394) 8.1% (12.9%) 92.4 3.18sec 17464 19503 Direct 93.0 8898 18230 10848 20.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.45 92.96 0.00 0.00 0.8954 0.0000 1008463.42 1008463.42 0.00 19502.79 19502.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.53 79.10% 8897.95 7949 11539 8902.89 8494 9417 654267 654267 0.00
crit 19.43 20.90% 18230.36 15898 23078 18247.92 16175 21200 354197 354197 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2025 4.8% 73.9 3.96sec 8197 0 Direct 73.9 8197 0 8197 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.93 73.93 0.00 0.00 0.0000 0.0000 605996.87 605996.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.93 100.00% 8197.26 5962 17308 8204.43 7002 9855 605997 605997 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 14170 33.9% 60.9 4.95sec 69610 66776 Direct 60.7 56939 117241 69829 21.4%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.91 60.72 0.00 0.00 1.0425 0.0000 4239788.17 4239788.17 0.00 66775.68 66775.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.74 78.63% 56939.25 51347 73781 56958.59 54292 59819 2718226 2718226 0.00
crit 12.98 21.37% 117241.10 102695 147561 117384.91 102695 137473 1521562 1521562 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1941 4.6% 12.7 23.57sec 45592 44457 Direct 12.7 2802 5778 3474 22.6%  
Periodic 220.4 1999 4097 2436 20.8% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.74 12.74 220.37 220.37 1.0256 1.3345 581051.81 581051.81 0.00 1891.70 44456.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.87 77.43% 2802.42 2570 3731 2801.67 2570 3148 27655 27655 0.00
crit 2.88 22.57% 5778.11 5140 7462 5592.44 0 7462 16620 16620 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 174.5 79.17% 1998.68 4 2612 1999.54 1935 2086 348703 348703 0.00
crit 45.9 20.83% 4097.05 21 5223 4100.31 3853 4526 188073 188073 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6142 14.6% 89.7 3.10sec 20373 0 Direct 89.7 16392 32756 20373 24.3%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.72 89.72 0.00 0.00 0.0000 0.0000 1827969.97 1827969.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.89 75.67% 16391.72 16021 17623 16391.77 16021 17235 1112897 1112897 0.00
crit 21.83 24.33% 32756.34 32042 35246 32756.24 32042 35246 715073 715073 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3329 8.0% 18.0 16.52sec 55226 54294 Direct 18.0 4623 9324 5530 19.3%  
Periodic 222.0 3314 6794 4039 20.8% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.04 18.04 221.98 221.98 1.0172 1.3323 996286.54 996286.54 0.00 3172.09 54293.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.56 80.71% 4622.92 4112 5970 4623.13 4235 5099 67309 67309 0.00
crit 3.48 19.29% 9324.01 8225 11939 9108.58 0 11939 32451 32451 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 175.7 79.16% 3313.68 2 4328 3315.14 3218 3462 582272 582272 0.00
crit 46.3 20.84% 6793.59 23 8656 6798.66 6365 7565 314255 314255 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
ripple in space
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.54sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.65sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9028 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 53.6 44.3sec 5.0sec 92.81% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.57%
  • arcanic_pulsar_2:10.32%
  • arcanic_pulsar_3:10.99%
  • arcanic_pulsar_4:10.71%
  • arcanic_pulsar_5:13.81%
  • arcanic_pulsar_6:10.63%
  • arcanic_pulsar_7:10.76%
  • arcanic_pulsar_8:14.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 188.6sec 0.0sec 16.23% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.12% 7.69% 0.0(0.0) 2.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.5sec 37.5sec 25.85% 32.61% 0.0(0.0) 8.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.2sec 45.7sec 23.55% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.17% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.89%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.1 45.4 8.9sec 3.8sec 81.69% 99.69% 1.8(1.8) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.39%
  • lunar_empowerment_2:31.49%
  • lunar_empowerment_3:13.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 399.2(399.2) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.5 64.5sec 33.8sec 48.04% 0.00% 3.5(48.5) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.99%
  • overwhelming_power_15:2.05%
  • overwhelming_power_16:2.11%
  • overwhelming_power_17:2.17%
  • overwhelming_power_18:2.23%
  • overwhelming_power_19:2.30%
  • overwhelming_power_20:2.37%
  • overwhelming_power_21:2.44%
  • overwhelming_power_22:2.52%
  • overwhelming_power_23:2.59%
  • overwhelming_power_24:2.67%
  • overwhelming_power_25:1.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Reality Shift 5.4 0.0 60.4sec 60.4sec 35.17% 0.00% 105.2(105.2) 5.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_reality_shift
  • max_stacks:1
  • duration:20.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Buff details

  • stat:intellect
  • amount:805.18

Stack Uptimes

  • reality_shift_1:35.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302916
  • name:Reality Shift
  • tooltip:
  • description:$?a302961[Your movement speed is increased by {$302961s1=5}%, and when][When] you move more than {$s1=25} yds within {$s4=4} sec, gain {$s2=194} $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] for {$302952d=15 seconds}. This can only occur once every {$302953d=30 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Solar Empowerment 24.5 51.7 12.0sec 3.9sec 85.48% 79.65% 0.3(0.3) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.05%
  • solar_empowerment_2:39.51%
  • solar_empowerment_3:17.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.7 20.3sec 4.9sec 97.06% 92.04% 15.8(15.8) 11.3

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.78%
  • starlord_2:22.30%
  • starlord_3:59.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.2sec 45.8sec 23.63% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.63%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
ripple in space
starsurge Astral Power 60.9 2436.3 40.0 40.0 1740.2
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 93.45 747.53 (31.16%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.33%) 40.00 0.00 0.00%
sunfire Astral Power 18.04 54.12 (2.26%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.48 177.93 (7.42%) 4.00 0.01 0.00%
moonfire Astral Power 14.04 42.11 (1.76%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.74 101.96 (4.25%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.70 920.33 (38.36%) 12.00 0.06 0.01%
natures_balance Astral Power 400.21 200.10 (8.34%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.24 74.94 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.00 8.13
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.27 0.00 80.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data ripple in space Fight Length
Count 14412
Mean 299.78
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data ripple in space Damage Per Second
Count 14412
Mean 41813.79
Minimum 37232.27
Maximum 47202.64
Spread ( max - min ) 9970.37
Range [ ( max - min ) / 2 * 100% ] 11.92%
Standard Deviation 1374.3374
5th Percentile 39648.93
95th Percentile 44151.45
( 95th Percentile - 5th Percentile ) 4502.52
Mean Distribution
Standard Deviation 11.4480
95.00% Confidence Intervall ( 41791.35 - 41836.23 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4150
0.1 Scale Factor Error with Delta=300 16124
0.05 Scale Factor Error with Delta=300 64496
0.01 Scale Factor Error with Delta=300 1612392
Priority Target DPS
Sample Data ripple in space Priority Target Damage Per Second
Count 14412
Mean 41813.79
Minimum 37232.27
Maximum 47202.64
Spread ( max - min ) 9970.37
Range [ ( max - min ) / 2 * 100% ] 11.92%
Standard Deviation 1374.3374
5th Percentile 39648.93
95th Percentile 44151.45
( 95th Percentile - 5th Percentile ) 4502.52
Mean Distribution
Standard Deviation 11.4480
95.00% Confidence Intervall ( 41791.35 - 41836.23 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4150
0.1 Scale Factor Error with Delta=300 16124
0.05 Scale Factor Error with Delta=300 64496
0.01 Scale Factor Error with Delta=300 1612392
DPS(e)
Sample Data ripple in space Damage Per Second (Effective)
Count 14412
Mean 41813.79
Minimum 37232.27
Maximum 47202.64
Spread ( max - min ) 9970.37
Range [ ( max - min ) / 2 * 100% ] 11.92%
Damage
Sample Data ripple in space Damage
Count 14412
Mean 12504070.34
Minimum 9699194.37
Maximum 15442937.13
Spread ( max - min ) 5743742.76
Range [ ( max - min ) / 2 * 100% ] 22.97%
DTPS
Sample Data ripple in space Damage Taken Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ripple in space Healing Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ripple in space Healing Per Second (Effective)
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ripple in space Heal
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ripple in space Healing Taken Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ripple in space Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ripple in spaceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ripple in space Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
H 5.47 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.94 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.91 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.99 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.79 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.59 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.25 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.74 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 77.05 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 92.71 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.46 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRKRQRKRQRKRQNRQORQRSKPKRLQKQRQRRQRRKRKRQRQRMKKNPQRQRKRQQKRQHNKORQKRPQQKRQRRNRRRKOKRQKLQRQKPRQQRRRQKKONQQKRQRKQPRHQRRGKNOKRQKRQRLQKQQRRPRQJKKQQKORNQRKQRRRRRRKPKQQNORKRQKRQHQRQRKQIEFKNPRKORQRKRQRQRQJKRKRKNQQPROQRRRKRQJKRKLQKRQQRKQOPHQNKGRQRKRQQKRQRKROQNPRKRQKRQLQKQRRKQRRORQKPKNQQRKQRRRKHQORRKNQPRRKRQKRQLRRRRQRKK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ripple in space 58.0/100: 58% astral_power
Pre precombat 1 food ripple in space 58.0/100: 58% astral_power
Pre precombat 2 augmentation ripple in space 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H ripple_in_space Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.238 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:02.190 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.113 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.039 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.966 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.773 default F berserking Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.773 default G use_items Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.773 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:06.528 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.283 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.036 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.792 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.637 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.391 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.145 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.898 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.707 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.460 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.215 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.972 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.751 default N sunfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.505 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.260 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.039 default O moonfire Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.793 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.548 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.372 default R solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.128 default S sunfire Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.881 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.635 default P stellar_flare Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.390 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, ignition_mages_fuse(5)
0:24.144 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), ignition_mages_fuse(5)
0:24.900 default L sunfire Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), ignition_mages_fuse(5)
0:25.652 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), ignition_mages_fuse(5)
0:26.591 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2)
0:27.492 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:28.607 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3)
0:29.362 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
0:30.477 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3)
0:31.230 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3)
0:31.982 default Q lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3)
0:33.097 default R solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:33.973 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:34.848 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:35.725 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
0:36.479 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3)
0:37.238 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
0:37.992 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3)
0:38.962 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
0:39.716 default Q lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3)
0:40.686 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3)
0:41.442 default M moonfire Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements
0:42.432 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar, lunar_empowerment, torrent_of_elements
0:43.672 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements
0:44.872 default N sunfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements
0:46.039 default P stellar_flare Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements
0:47.208 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements
0:48.697 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers
0:49.689 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
0:51.177 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers
0:52.169 default K starsurge Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
0:53.337 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
0:54.303 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
0:55.750 default Q lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
0:57.198 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
0:58.334 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
0:59.299 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:00.748 default H ripple_in_space Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:01.883 default N sunfire Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:03.019 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), conch_of_dark_whispers
1:04.259 default O moonfire Fluffy_Pillow 15.5/100: 16% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord, conch_of_dark_whispers
1:05.461 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord
1:06.482 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord
1:08.013 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord
1:09.216 default R solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2)
1:10.208 default P stellar_flare Fluffy_Pillow 10.5/100: 11% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:11.378 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:12.866 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2)
1:14.354 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment(2), starlord(2)
1:15.523 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3)
1:16.491 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
1:17.939 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(25)
1:18.821 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(24)
1:19.707 default N sunfire Fluffy_Pillow 49.0/100: 49% astral_power reality_shift, arcanic_pulsar(8), starlord(3), overwhelming_power(23)
1:20.756 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power reality_shift, arcanic_pulsar(8), starlord(3), overwhelming_power(22)
1:21.806 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power reality_shift, arcanic_pulsar(8), starlord(3), overwhelming_power(21)
1:22.860 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(20)
1:23.918 default K starsurge Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(8), lunar_empowerment, overwhelming_power(19)
1:25.074 default O moonfire Fluffy_Pillow 51.5/100: 52% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(17)
1:26.058 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(16)
1:27.044 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(15)
1:27.863 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(15)
1:29.089 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(13)
1:30.059 default L sunfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(12)
1:31.007 default Q lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(11)
1:32.399 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(10)
1:33.330 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(9)
1:34.730 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8)
1:35.834 default P stellar_flare Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(7)
1:36.941 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(6)
1:37.888 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5)
1:39.308 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(3)
1:40.739 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2)
1:41.700 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25)
1:42.582 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, overwhelming_power(24)
1:43.624 default Q lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
1:44.957 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
1:46.102 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers
1:47.220 default O moonfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers
1:48.312 default N sunfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers
1:49.406 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers
1:50.807 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers
1:52.212 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(14), conch_of_dark_whispers
1:53.321 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(13), conch_of_dark_whispers
1:54.241 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12), conch_of_dark_whispers
1:55.626 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers
1:56.552 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(10), conch_of_dark_whispers
1:57.647 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9), conch_of_dark_whispers
1:59.049 default P stellar_flare Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(7)
2:00.154 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(6)
2:01.098 default H ripple_in_space Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(5)
2:02.213 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(4)
2:03.640 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(3)
2:04.596 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power reality_shift, arcanic_pulsar(7), starlord(3), overwhelming_power(25)
2:05.636 default G use_items Fluffy_Pillow 74.5/100: 75% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, overwhelming_power(24)
2:05.636 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, overwhelming_power(24), ignition_mages_fuse
2:06.730 default N sunfire Fluffy_Pillow 35.0/100: 35% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(23), ignition_mages_fuse
2:07.794 default O moonfire Fluffy_Pillow 39.0/100: 39% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(22), ignition_mages_fuse
2:08.861 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(21), ignition_mages_fuse
2:09.931 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power reality_shift, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(20), ignition_mages_fuse(2)
2:10.686 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power reality_shift, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(19), ignition_mages_fuse(2)
2:11.803 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power reality_shift, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(18), ignition_mages_fuse(2)
2:12.685 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(17), ignition_mages_fuse(2)
2:13.440 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(16), ignition_mages_fuse(2)
2:14.537 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(15), ignition_mages_fuse(3)
2:15.290 default L sunfire Fluffy_Pillow 31.0/100: 31% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(14), ignition_mages_fuse(3)
2:16.124 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power reality_shift, arcanic_pulsar, lunar_empowerment(2), starlord(3), overwhelming_power(13), ignition_mages_fuse(3)
2:17.351 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power reality_shift, arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(12), ignition_mages_fuse(3)
2:18.317 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(11), ignition_mages_fuse(4)
2:19.507 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10), ignition_mages_fuse(4)
2:20.699 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power reality_shift, arcanic_pulsar(2), solar_empowerment(3), starlord(3), overwhelming_power(9), ignition_mages_fuse(4)
2:21.496 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power reality_shift, arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(8), ignition_mages_fuse(4)
2:22.297 default P stellar_flare Fluffy_Pillow 58.5/100: 59% astral_power reality_shift, arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(7), ignition_mages_fuse(5)
2:23.210 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(6), ignition_mages_fuse(5)
2:23.988 default Q lunar_strike Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(6), ignition_mages_fuse(5)
2:25.154 default J cancel_buff Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(4), ignition_mages_fuse(5)
2:25.154 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(2), overwhelming_power(4), ignition_mages_fuse(5)
2:26.155 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(3)
2:27.344 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(2)
2:28.823 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power
2:30.306 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2)
2:31.475 default O moonfire Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3)
2:32.613 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3)
2:33.581 default N sunfire Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
2:34.717 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
2:36.167 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3)
2:37.133 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3)
2:38.270 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
2:39.716 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
2:40.682 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3)
2:41.649 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(6), starlord(3)
2:42.787 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), starlord(3)
2:43.924 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(6), starlord(3)
2:45.061 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(25), conch_of_dark_whispers
2:46.100 default K starsurge Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(6), overwhelming_power(24), conch_of_dark_whispers
2:47.238 default P stellar_flare Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(23), conch_of_dark_whispers
2:48.347 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(22), conch_of_dark_whispers
2:49.459 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21), conch_of_dark_whispers
2:50.839 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24), conch_of_dark_whispers
2:52.204 default N sunfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(22), conch_of_dark_whispers
2:53.285 default O moonfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(21), conch_of_dark_whispers
2:54.367 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(20), conch_of_dark_whispers
2:55.291 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(19), conch_of_dark_whispers
2:56.381 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers
2:57.152 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers
2:58.313 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers
2:59.228 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers
3:00.008 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(20), conch_of_dark_whispers
3:01.179 default H ripple_in_space Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(19)
3:02.100 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18)
3:03.456 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power reality_shift, arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(17)
3:04.364 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power reality_shift, arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(16)
3:05.730 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power reality_shift, arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(15)
3:06.645 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power reality_shift, arcanic_pulsar, overwhelming_power(14)
3:07.822 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13)
3:09.284 default I celestial_alignment Fluffy_Pillow 46.0/100: 46% astral_power reality_shift, arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord, overwhelming_power(11)
3:10.289 default E potion Fluffy_Pillow 86.5/100: 87% astral_power reality_shift, arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord, overwhelming_power(10)
3:10.289 default F berserking Fluffy_Pillow 86.5/100: 87% astral_power reality_shift, arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord, overwhelming_power(10), battle_potion_of_intellect
3:10.289 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord, overwhelming_power(10), battle_potion_of_intellect
3:11.208 default N sunfire Fluffy_Pillow 47.0/100: 47% astral_power berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(9), conch_of_dark_whispers, battle_potion_of_intellect
3:12.103 default P stellar_flare Fluffy_Pillow 51.0/100: 51% astral_power berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(8), conch_of_dark_whispers, battle_potion_of_intellect
3:13.001 default R solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(7), conch_of_dark_whispers, battle_potion_of_intellect
3:13.769 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(7), conch_of_dark_whispers, battle_potion_of_intellect
3:14.671 default O moonfire Fluffy_Pillow 32.5/100: 33% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(6), conch_of_dark_whispers, battle_potion_of_intellect
3:15.549 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(5), conch_of_dark_whispers, battle_potion_of_intellect
3:16.305 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(4), conch_of_dark_whispers, battle_potion_of_intellect
3:17.432 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(3), conch_of_dark_whispers, battle_potion_of_intellect
3:18.188 default K starsurge Fluffy_Pillow 70.0/100: 70% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2), conch_of_dark_whispers, battle_potion_of_intellect
3:19.081 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power, conch_of_dark_whispers, battle_potion_of_intellect
3:19.843 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power, conch_of_dark_whispers, battle_potion_of_intellect
3:20.984 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:21.748 default Q lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:22.893 default R solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:23.733 default Q lunar_strike Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:24.993 default J cancel_buff Fluffy_Pillow 98.5/100: 99% astral_power arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:24.993 default K starsurge Fluffy_Pillow 98.5/100: 99% astral_power arcanic_pulsar(5), celestial_alignment, solar_empowerment, conch_of_dark_whispers, battle_potion_of_intellect
3:26.071 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, battle_potion_of_intellect
3:26.960 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
3:28.006 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
3:28.870 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect
3:29.886 default N sunfire Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:31.022 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:32.470 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:33.916 default P stellar_flare Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:35.050 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:36.015 default O moonfire Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
3:37.154 default Q lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
3:38.600 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3)
3:39.564 default R solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3)
3:40.530 default R solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(8), starlord(3)
3:41.666 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(8), starlord(3)
3:42.801 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
3:43.641 default Q lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power celestial_alignment, lunar_empowerment, starlord(3)
3:44.902 default J cancel_buff Fluffy_Pillow 89.5/100: 90% astral_power celestial_alignment, starlord(3)
3:44.902 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power celestial_alignment
3:45.981 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord
3:46.871 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord
3:47.918 default L sunfire Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
3:48.936 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2)
3:50.424 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
3:51.592 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
3:52.560 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:54.007 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:55.454 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:56.419 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
3:57.556 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:59.002 default O moonfire Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:00.138 default P stellar_flare Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:01.276 default H ripple_in_space Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:02.413 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:03.861 default N sunfire Fluffy_Pillow 52.5/100: 53% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:04.996 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment(2)
4:06.235 default G use_items Fluffy_Pillow 21.0/100: 21% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord
4:06.235 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, ignition_mages_fuse
4:07.213 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, ignition_mages_fuse
4:08.681 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, ignition_mages_fuse
4:09.658 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, ignition_mages_fuse
4:10.809 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), ignition_mages_fuse(2)
4:11.722 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), ignition_mages_fuse(2)
4:13.089 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse(2)
4:14.457 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment(2), starlord(2), ignition_mages_fuse(3)
4:15.488 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), ignition_mages_fuse(3)
4:16.339 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
4:17.617 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment(3), starlord(3), ignition_mages_fuse(3)
4:18.470 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:19.435 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:20.256 default O moonfire Fluffy_Pillow 10.5/100: 11% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.223 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:22.454 default N sunfire Fluffy_Pillow 26.5/100: 27% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
4:23.386 default P stellar_flare Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
4:24.320 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
4:25.109 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(5)
4:26.124 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(5)
4:26.880 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
4:28.212 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
4:29.260 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
4:30.124 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
4:31.418 default L sunfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers
4:32.350 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
4:33.720 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(22)
4:34.798 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21)
4:36.139 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19)
4:37.042 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18)
4:37.948 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power(18)
4:39.013 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16)
4:40.379 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15)
4:41.296 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, overwhelming_power(14)
4:42.375 default O moonfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, overwhelming_power(13)
4:43.460 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, overwhelming_power(12)
4:44.548 default Q lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(11)
4:45.937 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(3), torrent_of_elements, overwhelming_power(10)
4:47.131 default P stellar_flare Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(8)
4:48.298 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(7)
4:49.469 default N sunfire Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(6)
4:50.613 default Q lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(5)
4:52.074 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(3)
4:53.547 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(2)
4:54.533 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), overwhelming_power
4:55.697 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
4:57.144 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3)
4:58.110 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
4:59.078 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3)
5:00.045 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(6), starlord(3)
5:01.181 default H ripple_in_space Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3)
5:02.411 default Q lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3)
5:03.858 default O moonfire Fluffy_Pillow 18.5/100: 19% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment, starlord(3)
5:04.994 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment, starlord(3)
5:05.961 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power reality_shift, arcanic_pulsar(7), overwhelming_power(25)
5:07.093 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power reality_shift, arcanic_pulsar(7), overwhelming_power(23)
5:08.233 default N sunfire Fluffy_Pillow 4.0/100: 4% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(22)
5:09.344 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(21)
5:10.764 default P stellar_flare Fluffy_Pillow 21.0/100: 21% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment, starlord, overwhelming_power(20)
5:11.882 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment, starlord, overwhelming_power(25)
5:12.817 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power reality_shift, arcanic_pulsar(8), starlord, overwhelming_power(24)
5:13.920 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power reality_shift, arcanic_pulsar(8), starlord, overwhelming_power(23)
5:15.028 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(21)
5:15.829 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power reality_shift, celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(21)
5:17.029 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power reality_shift, celestial_alignment, starlord(2), overwhelming_power(19)
5:17.978 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(19)
5:18.762 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(18)
5:19.940 default L sunfire Fluffy_Pillow 23.0/100: 23% astral_power reality_shift, arcanic_pulsar, celestial_alignment, starlord(3), overwhelming_power(17)
5:20.870 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power reality_shift, arcanic_pulsar, starlord(3), overwhelming_power(16)
5:21.942 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power reality_shift, arcanic_pulsar, starlord(3), overwhelming_power(15)
5:23.018 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power reality_shift, arcanic_pulsar, starlord(3), overwhelming_power(13)
5:24.101 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar, starlord(3), overwhelming_power(12)
5:25.189 default Q lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(11)
5:26.579 default R solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(10)
5:27.511 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar, overwhelming_power(9)
5:28.710 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(8)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="ripple in space"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

unbound force : 42735 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
42734.9 42734.9 21.7 / 0.051% 5132.2 / 12.0% 5232.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 8.0 Astral Power 0.00% 58.5 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
unbound force 42735
Heed My Call 312 (445) 0.7% (1.0%) 8.2 32.96sec 16245 0 Direct 8.2 9127 18255 11376 24.6%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.21 8.21 0.00 0.00 0.0000 0.0000 93411.92 93411.92 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.19 75.36% 9126.54 8921 9813 9117.22 0 9813 56480 56480 0.00
crit 2.02 24.64% 18254.81 17842 19626 15977.70 0 19626 36932 36932 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 133 0.3% 8.2 32.96sec 4869 0 Direct 8.2 3912 7822 4869 24.5%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.21 8.21 0.00 0.00 0.0000 0.0000 39986.49 39986.49 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.20 75.51% 3911.59 3823 4206 3908.68 0 4206 24253 24253 0.00
crit 2.01 24.49% 7822.16 7646 8411 6835.86 0 8411 15733 15733 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6001 14.1% 76.9 3.80sec 23372 17995 Direct 76.9 18992 38410 23372 22.6%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.88 76.88 0.00 0.00 1.2988 0.0000 1796868.92 1796868.92 0.00 17995.14 17995.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.54 77.44% 18991.96 10135 24211 18999.01 18263 19888 1130715 1130715 0.00
crit 17.34 22.56% 38409.91 20270 48422 38437.74 35116 42933 666154 666154 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2994 7.0% 14.0 21.38sec 63900 63224 Direct 14.0 3271 6611 4071 24.0%  
Periodic 222.9 3011 6104 3764 24.3% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.02 14.02 222.94 222.94 1.0107 1.3304 896137.69 896137.69 0.00 2883.52 63224.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.66 76.03% 3270.57 2981 4065 3272.06 3007 3572 34873 34873 0.00
crit 3.36 23.97% 6611.04 5963 8130 6478.77 0 8130 22223 22223 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 168.7 75.68% 3011.22 4 3785 3012.47 2920 3151 508031 508031 0.00
crit 54.2 24.32% 6104.30 16 7570 6107.70 5731 6601 331011 331011 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 966 2.3% 44.6 6.55sec 6484 0 Direct 44.6 5177 10494 6484 24.6%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.58 44.58 0.00 0.00 0.0000 0.0000 289015.74 289015.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.62 75.43% 5177.19 4769 6503 5179.03 4811 5759 174078 174078 0.00
crit 10.95 24.57% 10493.68 9539 13006 10499.07 9539 12710 114938 114938 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3348 (5353) 7.8% (12.5%) 92.9 3.16sec 17249 19231 Direct 93.4 8659 17599 10726 23.1%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.91 93.43 0.00 0.00 0.8969 0.0000 1002151.43 1002151.43 0.00 19230.68 19230.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.82 76.88% 8659.06 7949 10838 8663.66 8366 9103 621924 621924 0.00
crit 21.61 23.12% 17598.74 15898 21676 17612.84 16115 19782 380227 380227 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2006 4.7% 74.1 3.95sec 8109 0 Direct 74.1 8109 0 8109 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.05 74.05 0.00 0.00 0.0000 0.0000 600495.17 600495.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.05 100.00% 8108.73 5962 16257 8114.41 6947 9861 600495 600495 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 14178 33.2% 61.1 4.94sec 69468 66614 Direct 60.9 55713 113494 69694 24.2%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.07 60.87 0.00 0.00 1.0429 0.0000 4242571.63 4242571.63 0.00 66613.88 66613.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.14 75.80% 55712.61 51347 69612 55732.35 53307 59258 2570797 2570797 0.00
crit 14.73 24.20% 113494.18 102695 139223 113582.59 102695 129473 1671774 1671774 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1942 4.5% 12.7 23.57sec 45611 44544 Direct 12.7 2755 5598 3479 25.5%  
Periodic 220.5 1951 3957 2436 24.2% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.75 12.75 220.45 220.45 1.0240 1.3340 581342.28 581342.28 0.00 1892.73 44543.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.50 74.53% 2755.14 2570 3504 2755.06 2570 3041 26174 26174 0.00
crit 3.25 25.47% 5598.21 5140 7009 5492.12 0 7009 18171 18171 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 167.2 75.84% 1951.14 9 2453 1951.96 1894 2041 326196 326196 0.00
crit 53.3 24.16% 3957.10 7 4906 3959.19 3738 4235 210802 210802 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6204 14.4% 89.2 3.11sec 20701 0 Direct 89.2 16391 32756 20701 26.3%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.20 89.20 0.00 0.00 0.0000 0.0000 1846626.71 1846626.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.71 73.66% 16391.15 16021 17623 16391.26 16021 17361 1077088 1077088 0.00
crit 23.49 26.34% 32756.18 32042 35246 32755.36 32042 34925 769538 769538 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3332 7.8% 18.0 16.49sec 55263 54386 Direct 18.0 4502 9017 5537 22.9%  
Periodic 222.1 3234 6558 4041 24.3% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.05 18.05 222.07 222.07 1.0161 1.3317 997378.72 997378.72 0.00 3175.68 54385.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.91 77.07% 4501.96 4112 5607 4502.43 4194 4856 62621 62621 0.00
crit 4.14 22.93% 9017.30 8225 11214 8933.19 0 11214 37316 37316 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 168.1 75.72% 3234.08 2 4065 3235.43 3137 3400 543788 543788 0.00
crit 53.9 24.28% 6558.00 16 8130 6561.50 6189 7071 353654 353654 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
The Unbound Force 1321 3.1% 4.9 68.36sec 81681 73910 Periodic 59.2 1593 8206 6690 77.1% 3.2%

Stats details: the_unbound_force

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.85 0.00 38.69 59.24 1.1053 0.2500 396302.93 396302.93 0.00 26362.20 73909.54
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.6 22.92% 1593.32 105 1902 1591.27 1188 1844 21634 21634 0.00
crit 45.7 77.08% 8205.93 524 9509 8205.52 7585 9221 374669 374669 0.00
 
 

Action details: the_unbound_force

Static Values
  • id:298452
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.reckless_force.up|time<5
Spelldata
  • id:298452
  • name:The Unbound Force
  • school:fire
  • tooltip:
  • description:Unleash the forces within the Heart of Azeroth, causing shards of Azerite to strike your target for ${({$298407s3=378}*(({$d=2 seconds}/$t)+1)+{$298407s3=378})} Fire damage over {$d=2 seconds}. This damage is increased by {$s2=300}% if it critically strikes.$?a298456[ Each time The Unbound Force causes a critical strike, it immediately strikes the target with an additional Azerite shard, up to a maximum of $298456m2.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: the_unbound_force_tick

Static Values
  • id:298453
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:50.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:298453
  • name:The Unbound Force
  • school:fire
  • tooltip:
  • description:{$@spelldesc298452=Unleash the forces within the Heart of Azeroth, causing shards of Azerite to strike your target for ${({$298407s3=378}*(({$d=2 seconds}/$t)+1)+{$298407s3=378})} Fire damage over {$d=2 seconds}. This damage is increased by {$s2=300}% if it critically strikes.$?a298456[ Each time The Unbound Force causes a critical strike, it immediately strikes the target with an additional Azerite shard, up to a maximum of $298456m2.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1571.35
  • base_dd_max:1571.35
  • base_dd_mult:1.00
 
Simple Action Stats Execute Interval
unbound force
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.59sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.66sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9001 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 53.7 44.2sec 4.9sec 92.76% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.58%
  • arcanic_pulsar_2:10.41%
  • arcanic_pulsar_3:11.19%
  • arcanic_pulsar_4:10.60%
  • arcanic_pulsar_5:13.72%
  • arcanic_pulsar_6:10.52%
  • arcanic_pulsar_7:10.74%
  • arcanic_pulsar_8:13.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 188.6sec 0.0sec 16.23% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.12% 7.74% 0.0(0.0) 2.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.4sec 37.4sec 25.88% 32.54% 0.0(0.0) 8.1

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.0sec 45.5sec 23.71% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.9 0.0 120.3sec 120.3sec 19.17% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.89%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.7 46.1 9.0sec 3.8sec 82.09% 99.70% 1.9(1.9) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.80%
  • lunar_empowerment_2:31.91%
  • lunar_empowerment_3:14.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 399.2(399.2) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.5 64.4sec 33.7sec 48.07% 0.00% 3.5(48.7) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.04%
  • overwhelming_power_16:2.11%
  • overwhelming_power_17:2.17%
  • overwhelming_power_18:2.23%
  • overwhelming_power_19:2.30%
  • overwhelming_power_20:2.37%
  • overwhelming_power_21:2.44%
  • overwhelming_power_22:2.52%
  • overwhelming_power_23:2.60%
  • overwhelming_power_24:2.67%
  • overwhelming_power_25:1.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Reckless Force 3.9 0.0 68.2sec 68.2sec 5.13% 0.00% 0.0(0.0) 3.8

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_reckless_force
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.70
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • reckless_force_1:5.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302932
  • name:Reckless Force
  • tooltip:Critical Strike increased by {$s1=50}%.
  • description:{$@spelldesc298407=When an ability fails to critically strike, you have a high chance to gain Reckless Force. When Reckless Force reaches {$302917u=20} stacks, your critical strike is increased by {$302932s1=50}% for {$302932d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Reckless Force (_counter) 4.8 82.0 68.7sec 3.4sec 91.60% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_reckless_force_counter
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • reckless_force_counter_1:5.75%
  • reckless_force_counter_2:5.43%
  • reckless_force_counter_3:5.31%
  • reckless_force_counter_4:5.14%
  • reckless_force_counter_5:5.06%
  • reckless_force_counter_6:4.99%
  • reckless_force_counter_7:4.91%
  • reckless_force_counter_8:4.87%
  • reckless_force_counter_9:4.82%
  • reckless_force_counter_10:4.76%
  • reckless_force_counter_11:4.69%
  • reckless_force_counter_12:4.68%
  • reckless_force_counter_13:4.63%
  • reckless_force_counter_14:4.56%
  • reckless_force_counter_15:4.50%
  • reckless_force_counter_16:4.44%
  • reckless_force_counter_17:4.43%
  • reckless_force_counter_18:4.34%
  • reckless_force_counter_19:4.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302917
  • name:Reckless Force
  • tooltip:Upon reaching {$u=20} stacks, you gain $302932s~1% Critical Strike for {$302932d=3 seconds}.
  • description:{$@spelldesc298407=When an ability fails to critically strike, you have a high chance to gain Reckless Force. When Reckless Force reaches {$302917u=20} stacks, your critical strike is increased by {$302932s1=50}% for {$302932d=3 seconds}.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Solar Empowerment 24.5 52.0 12.1sec 3.9sec 85.54% 79.39% 0.3(0.3) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:27.81%
  • solar_empowerment_2:39.97%
  • solar_empowerment_3:17.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.8 20.2sec 4.9sec 97.31% 92.22% 15.8(15.8) 11.2

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.36%
  • starlord_2:22.69%
  • starlord_3:60.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.0sec 45.7sec 23.59% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.59%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
unbound force
starsurge Astral Power 61.1 2442.9 40.0 40.0 1736.7
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 93.91 751.26 (31.23%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.33%) 40.00 0.00 0.00%
sunfire Astral Power 18.05 54.14 (2.25%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.58 178.29 (7.41%) 4.00 0.01 0.01%
moonfire Astral Power 14.02 42.07 (1.75%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.75 101.97 (4.24%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.88 922.50 (38.35%) 12.00 0.06 0.01%
natures_balance Astral Power 400.21 200.10 (8.32%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.26 75.16 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.02 8.15
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.26 0.00 77.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data unbound force Fight Length
Count 14412
Mean 299.78
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data unbound force Damage Per Second
Count 14412
Mean 42734.90
Minimum 38158.27
Maximum 48790.74
Spread ( max - min ) 10632.47
Range [ ( max - min ) / 2 * 100% ] 12.44%
Standard Deviation 1331.3880
5th Percentile 40636.76
95th Percentile 44986.84
( 95th Percentile - 5th Percentile ) 4350.08
Mean Distribution
Standard Deviation 11.0903
95.00% Confidence Intervall ( 42713.17 - 42756.64 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3729
0.1 Scale Factor Error with Delta=300 15132
0.05 Scale Factor Error with Delta=300 60528
0.01 Scale Factor Error with Delta=300 1513189
Priority Target DPS
Sample Data unbound force Priority Target Damage Per Second
Count 14412
Mean 42734.90
Minimum 38158.27
Maximum 48790.74
Spread ( max - min ) 10632.47
Range [ ( max - min ) / 2 * 100% ] 12.44%
Standard Deviation 1331.3880
5th Percentile 40636.76
95th Percentile 44986.84
( 95th Percentile - 5th Percentile ) 4350.08
Mean Distribution
Standard Deviation 11.0903
95.00% Confidence Intervall ( 42713.17 - 42756.64 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3729
0.1 Scale Factor Error with Delta=300 15132
0.05 Scale Factor Error with Delta=300 60528
0.01 Scale Factor Error with Delta=300 1513189
DPS(e)
Sample Data unbound force Damage Per Second (Effective)
Count 14412
Mean 42734.90
Minimum 38158.27
Maximum 48790.74
Spread ( max - min ) 10632.47
Range [ ( max - min ) / 2 * 100% ] 12.44%
Damage
Sample Data unbound force Damage
Count 14412
Mean 12782289.64
Minimum 9822075.47
Maximum 15937984.80
Spread ( max - min ) 6115909.33
Range [ ( max - min ) / 2 * 100% ] 23.92%
DTPS
Sample Data unbound force Damage Taken Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data unbound force Healing Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data unbound force Healing Per Second (Effective)
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data unbound force Heal
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data unbound force Healing Taken Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data unbound force Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data unbound forceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data unbound force Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
H 4.85 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 3.03 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.07 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.00 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.78 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.59 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.24 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.75 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 77.24 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 93.17 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.47 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRKRQKRQRQKRQNRQORQJKRKPRKQQQRRRRRKRKNRQRQMRJKKQRQKPRQKNRQQRRRQHKKOQQKNPRQRQRQRJKRKRQKMQKNQQQKPRQQRKRQKNORQRKQRQPRRRQKKGNRQKRMQQKQHRRRRRNPKKQRQKORQQKRQRRNRQRKKPQQKRQKRQMQKNRQRQKQRIEFKPRKORQKNRQRQRQRJKRKLQKRQHKPMQQRRQRRKKNQQKRQQKOPRQRQNGKKRQQKRQRRRROQRKNPRSKRMQKQKQHQKRQQNRPKQRKOQQRKQRQKNQRRRKRPKRQMQKQQNKQRQRRK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask unbound force 58.0/100: 58% astral_power
Pre precombat 1 food unbound force 58.0/100: 58% astral_power
Pre precombat 2 augmentation unbound force 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H the_unbound_force Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.240 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:02.192 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.118 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.043 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.968 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter, battle_potion_of_intellect
0:05.772 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter, battle_potion_of_intellect
0:05.772 default G use_items Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter, battle_potion_of_intellect
0:05.772 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse
0:06.528 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse
0:07.282 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse
0:08.037 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse
0:08.790 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse
0:09.634 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse
0:10.388 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.143 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.952 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.707 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.515 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.269 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.024 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.804 default N sunfire Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.558 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.313 default Q lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.090 default O moonfire Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.845 default R solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.600 default Q lunar_strike Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.571 default J cancel_buff Fluffy_Pillow 95.5/100: 96% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.571 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.326 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.081 default K starsurge Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord, reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.837 default P stellar_flare Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.593 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, reckless_force_counter(4), ignition_mages_fuse(5)
0:24.348 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(4), ignition_mages_fuse(5)
0:25.103 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(4), ignition_mages_fuse(5)
0:26.014 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(4)
0:27.130 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(5)
0:28.243 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(5)
0:28.997 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, reckless_force_counter(5)
0:29.872 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, reckless_force_counter(5)
0:30.749 default R solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, reckless_force_counter(6)
0:31.625 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, reckless_force_counter(6)
0:32.499 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, reckless_force_counter(6)
0:33.374 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(6)
0:34.129 default K starsurge Fluffy_Pillow 72.5/100: 73% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(6)
0:34.892 default N sunfire Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(7)
0:35.653 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(9)
0:36.407 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25), reckless_force_counter(9)
0:37.295 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), reckless_force_counter(9)
0:38.049 default Q lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), reckless_force_counter(10)
0:38.941 default M moonfire Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), reckless_force_counter(10)
0:39.696 default R solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), reckless_force_counter(10)
0:40.504 default J cancel_buff Fluffy_Pillow 99.0/100: 99% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), reckless_force_counter(10)
0:40.504 default K starsurge Fluffy_Pillow 99.0/100: 99% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, torrent_of_elements, overwhelming_power(21), reckless_force_counter(10)
0:41.388 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(20), reckless_force_counter(10)
0:42.507 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19), reckless_force_counter(10)
0:43.898 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(18), reckless_force_counter(12)
0:44.829 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(17), reckless_force_counter(13)
0:46.230 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(15), reckless_force_counter(15)
0:47.335 default P stellar_flare Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(14), reckless_force_counter(15)
0:48.414 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(13), reckless_force_counter(15)
0:49.336 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12), reckless_force_counter(15)
0:50.720 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11), reckless_force_counter(15)
0:51.813 default N sunfire Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(10), reckless_force_counter(16)
0:52.908 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(9), reckless_force_counter(17)
0:53.843 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(8), reckless_force_counter(18)
0:55.249 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(6), reckless_force_counter(18)
0:56.665 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(5), reckless_force_counter(18)
0:57.613 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(4), reckless_force_counter(18)
0:58.564 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(3), reckless_force_counter(18)
0:59.687 default Q lunar_strike Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), overwhelming_power(2), reckless_force_counter(19)
1:01.124 default H the_unbound_force Fluffy_Pillow 91.5/100: 92% astral_power reckless_force, arcanic_pulsar(5)
1:02.363 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power reckless_force, arcanic_pulsar(5)
1:03.601 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power reckless_force, arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord
1:04.804 default O moonfire Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:05.973 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter
1:07.461 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(2)
1:08.951 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), reckless_force_counter(2)
1:10.120 default N sunfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(3)
1:11.257 default P stellar_flare Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(3)
1:12.394 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(3)
1:13.361 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(3)
1:14.808 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), reckless_force_counter(4), conch_of_dark_whispers
1:15.774 default Q lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(4), conch_of_dark_whispers
1:17.220 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(4), conch_of_dark_whispers
1:18.185 default Q lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), reckless_force_counter(6), conch_of_dark_whispers
1:19.507 default R solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(24), reckless_force_counter(6), conch_of_dark_whispers
1:20.549 default J cancel_buff Fluffy_Pillow 98.5/100: 99% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), reckless_force_counter(7), conch_of_dark_whispers
1:20.549 default K starsurge Fluffy_Pillow 98.5/100: 99% astral_power arcanic_pulsar(8), lunar_empowerment, torrent_of_elements, overwhelming_power(23), reckless_force_counter(7), conch_of_dark_whispers
1:21.689 default R solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(22), reckless_force_counter(7), conch_of_dark_whispers
1:22.510 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(21), reckless_force_counter(7), conch_of_dark_whispers
1:23.481 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(20), reckless_force_counter(7), conch_of_dark_whispers
1:24.287 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(19), reckless_force_counter(7), conch_of_dark_whispers
1:25.495 default K starsurge Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(18), reckless_force_counter(7), conch_of_dark_whispers
1:26.445 default M moonfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17), reckless_force_counter(7), conch_of_dark_whispers
1:27.375 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16), reckless_force_counter(7), conch_of_dark_whispers
1:28.741 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15), reckless_force_counter(7), conch_of_dark_whispers
1:29.818 default N sunfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), reckless_force_counter(8), conch_of_dark_whispers
1:30.897 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13), reckless_force_counter(8), conch_of_dark_whispers
1:32.276 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11), reckless_force_counter(9), conch_of_dark_whispers
1:33.666 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10), reckless_force_counter(9)
1:35.062 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(8), reckless_force_counter(9)
1:36.164 default P stellar_flare Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(7), reckless_force_counter(9)
1:37.272 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(6), reckless_force_counter(10)
1:38.217 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(5), reckless_force_counter(10)
1:39.637 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4), reckless_force_counter(11)
1:41.063 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(4), solar_empowerment(3), overwhelming_power(2), reckless_force_counter(11)
1:42.108 default K starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(4), solar_empowerment(2), overwhelming_power, reckless_force_counter(11)
1:43.342 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, reckless_force_counter(11)
1:44.365 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, reckless_force_counter(12)
1:45.897 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, reckless_force_counter(13)
1:47.101 default N sunfire Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), reckless_force_counter(13)
1:48.269 default O moonfire Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), reckless_force_counter(13)
1:49.438 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), reckless_force_counter(13)
1:50.430 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(13)
1:51.919 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), reckless_force_counter(14)
1:52.911 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), reckless_force_counter(14)
1:54.078 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(14)
1:55.526 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(14)
1:56.492 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(14)
1:57.940 default P stellar_flare Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3), reckless_force_counter(14)
1:59.076 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3), reckless_force_counter(15)
2:00.040 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), reckless_force_counter(15)
2:01.006 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), reckless_force_counter(15)
2:01.976 default Q lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), reckless_force_counter(15)
2:03.424 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(7), reckless_force_counter(15)
2:04.662 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(16)
2:05.864 default G use_items Fluffy_Pillow 24.5/100: 25% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(16), conch_of_dark_whispers
2:05.864 default N sunfire Fluffy_Pillow 24.5/100: 25% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(16), conch_of_dark_whispers, ignition_mages_fuse
2:06.838 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(17), conch_of_dark_whispers, ignition_mages_fuse
2:07.667 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), reckless_force_counter(17), conch_of_dark_whispers, ignition_mages_fuse
2:08.907 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), reckless_force_counter(17), conch_of_dark_whispers, ignition_mages_fuse
2:09.882 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(17), conch_of_dark_whispers, ignition_mages_fuse(2)
2:10.655 default M moonfire Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(18), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.563 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(18), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.893 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(18), conch_of_dark_whispers, ignition_mages_fuse(2)
2:14.223 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, solar_empowerment, starlord(3), reckless_force_counter(18), conch_of_dark_whispers, ignition_mages_fuse(3)
2:15.226 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(19), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.503 default H the_unbound_force Fluffy_Pillow 26.0/100: 26% astral_power reckless_force, arcanic_pulsar(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.507 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power reckless_force, arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(25), conch_of_dark_whispers, ignition_mages_fuse(3)
2:18.297 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power reckless_force, arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(24), conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.061 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power reckless_force, arcanic_pulsar(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.961 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.863 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(22), ignition_mages_fuse(4)
2:21.767 default N sunfire Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(21), ignition_mages_fuse(4)
2:22.672 default P stellar_flare Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(20), ignition_mages_fuse(5)
2:23.549 default K starsurge Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(2), lunar_empowerment, overwhelming_power(19), reckless_force_counter, ignition_mages_fuse(5)
2:24.508 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(18), reckless_force_counter, ignition_mages_fuse(5)
2:25.440 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(17), reckless_force_counter, ignition_mages_fuse(5)
2:26.601 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(16), reckless_force_counter
2:27.540 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(15), reckless_force_counter
2:28.949 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25), reckless_force_counter(2)
2:30.016 default O moonfire Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23), reckless_force_counter(2)
2:31.062 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(22), reckless_force_counter(2)
2:31.958 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), reckless_force_counter(2)
2:33.295 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20), reckless_force_counter(2)
2:34.641 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(19), reckless_force_counter(2)
2:35.701 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(18), reckless_force_counter(3)
2:36.606 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), reckless_force_counter(4)
2:37.965 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(16), reckless_force_counter(4)
2:38.877 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(15), reckless_force_counter(4)
2:39.792 default N sunfire Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(14), reckless_force_counter(4)
2:40.871 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(13), reckless_force_counter(4)
2:41.956 default Q lunar_strike Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), overwhelming_power(12), reckless_force_counter(5)
2:43.342 default R solar_wrath Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(10), reckless_force_counter(5)
2:44.440 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(6), lunar_empowerment, overwhelming_power(9), reckless_force_counter(6)
2:45.637 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(8), reckless_force_counter(7)
2:46.805 default P stellar_flare Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(7), reckless_force_counter(7)
2:47.945 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(25), reckless_force_counter(7)
2:49.305 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23), reckless_force_counter(7)
2:50.673 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22), reckless_force_counter(7)
2:51.751 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(21), reckless_force_counter(7)
2:52.529 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20), reckless_force_counter(7)
2:53.701 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19), reckless_force_counter(7)
2:54.626 default R solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(18), reckless_force_counter(7)
2:55.414 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), reckless_force_counter(8)
2:56.598 default M moonfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), reckless_force_counter(9)
2:57.531 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), reckless_force_counter(9)
2:58.903 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), reckless_force_counter(10)
2:59.983 default N sunfire Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(13), reckless_force_counter(10)
3:01.069 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(11), reckless_force_counter(12)
3:01.995 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11), reckless_force_counter(12)
3:03.386 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), reckless_force_counter(12)
3:04.319 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(8), reckless_force_counter(12)
3:05.726 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(2), solar_empowerment, torrent_of_elements, overwhelming_power(7), reckless_force_counter(13)
3:06.932 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(6), reckless_force_counter(14)
3:08.430 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(4), reckless_force_counter(14)
3:09.439 default I celestial_alignment Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(3), reckless_force_counter(14)
3:10.473 default E potion Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment(2), starlord, overwhelming_power(2), reckless_force_counter(14)
3:10.473 default F berserking Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment(2), starlord, overwhelming_power(2), reckless_force_counter(14), battle_potion_of_intellect
3:10.473 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power berserking, arcanic_pulsar(3), celestial_alignment, solar_empowerment(2), starlord, overwhelming_power(2), reckless_force_counter(14), battle_potion_of_intellect
3:11.419 default P stellar_flare Fluffy_Pillow 53.5/100: 54% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power, reckless_force_counter(14), battle_potion_of_intellect
3:12.340 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), reckless_force_counter(14), battle_potion_of_intellect
3:13.127 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(14), battle_potion_of_intellect
3:14.051 default O moonfire Fluffy_Pillow 35.0/100: 35% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(14), battle_potion_of_intellect
3:14.951 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(15), battle_potion_of_intellect
3:15.714 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(15), battle_potion_of_intellect
3:16.860 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(15), battle_potion_of_intellect
3:17.759 default N sunfire Fluffy_Pillow 20.5/100: 21% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(15), conch_of_dark_whispers, battle_potion_of_intellect
3:18.659 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(15), conch_of_dark_whispers, battle_potion_of_intellect
3:19.423 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(15), conch_of_dark_whispers, battle_potion_of_intellect
3:20.567 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(16), conch_of_dark_whispers, battle_potion_of_intellect
3:21.331 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(16), conch_of_dark_whispers, battle_potion_of_intellect
3:22.475 default R solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(16), conch_of_dark_whispers, battle_potion_of_intellect
3:23.316 default Q lunar_strike Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(16), conch_of_dark_whispers, battle_potion_of_intellect
3:24.574 default R solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(6), celestial_alignment, solar_empowerment, starlord(3), reckless_force_counter(16), conch_of_dark_whispers, battle_potion_of_intellect
3:25.415 default J cancel_buff Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar(6), celestial_alignment, starlord(3), reckless_force_counter(16), conch_of_dark_whispers, battle_potion_of_intellect
3:25.415 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar(6), celestial_alignment, reckless_force_counter(16), conch_of_dark_whispers, battle_potion_of_intellect
3:26.493 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(16), conch_of_dark_whispers, battle_potion_of_intellect
3:27.384 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord, reckless_force_counter(16), conch_of_dark_whispers, battle_potion_of_intellect
3:28.432 default L sunfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), reckless_force_counter(17), conch_of_dark_whispers, battle_potion_of_intellect
3:29.448 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(2), reckless_force_counter(17), conch_of_dark_whispers, battle_potion_of_intellect
3:30.938 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), reckless_force_counter(18), conch_of_dark_whispers, battle_potion_of_intellect
3:32.108 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(18), conch_of_dark_whispers, battle_potion_of_intellect
3:32.948 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(19), conch_of_dark_whispers, battle_potion_of_intellect
3:34.207 default H the_unbound_force Fluffy_Pillow 41.5/100: 42% astral_power reckless_force, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), battle_potion_of_intellect
3:35.194 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power reckless_force, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), battle_potion_of_intellect
3:36.183 default P stellar_flare Fluffy_Pillow 7.0/100: 7% astral_power reckless_force, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:37.172 default M moonfire Fluffy_Pillow 15.5/100: 16% astral_power reckless_force, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:38.162 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:39.611 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25), reckless_force_counter
3:40.934 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(24), reckless_force_counter
3:41.822 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(23), reckless_force_counter
3:42.711 default Q lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(22), reckless_force_counter
3:44.049 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar, starlord(3), overwhelming_power(20), reckless_force_counter(2)
3:45.107 default R solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar, starlord(3), overwhelming_power(19), reckless_force_counter(2)
3:46.169 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar, lunar_empowerment, overwhelming_power(18), reckless_force_counter(3)
3:47.330 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(17), reckless_force_counter(3)
3:48.460 default N sunfire Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(16), reckless_force_counter(3)
3:49.562 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(15), reckless_force_counter(3)
3:50.971 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(14), reckless_force_counter(4)
3:52.386 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(12), reckless_force_counter(4)
3:53.504 default R solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(11), reckless_force_counter(4)
3:54.433 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10), reckless_force_counter(4)
3:55.828 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), reckless_force_counter(4)
3:57.229 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7), reckless_force_counter(5)
3:58.336 default O moonfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(6), reckless_force_counter(5)
3:59.448 default P stellar_flare Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(5), reckless_force_counter(5)
4:00.563 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(4), reckless_force_counter(5)
4:01.514 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(3), reckless_force_counter(6)
4:02.945 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2), reckless_force_counter(7)
4:03.903 default Q lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power, reckless_force_counter(9)
4:05.346 default N sunfire Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(9)
4:06.483 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(5), solar_empowerment, torrent_of_elements, reckless_force_counter(10)
4:06.483 default K starsurge Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(5), solar_empowerment, torrent_of_elements, reckless_force_counter(10), ignition_mages_fuse
4:07.670 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, reckless_force_counter(11), ignition_mages_fuse
4:08.822 default R solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, reckless_force_counter(12), ignition_mages_fuse
4:09.771 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(12), ignition_mages_fuse
4:11.195 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(13), ignition_mages_fuse(2)
4:12.563 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(13), ignition_mages_fuse(2)
4:13.636 default R solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(14), ignition_mages_fuse(2)
4:14.525 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(14), ignition_mages_fuse(3)
4:15.805 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(14), ignition_mages_fuse(3)
4:16.660 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(14), ignition_mages_fuse(3)
4:17.513 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(15), ignition_mages_fuse(3)
4:18.365 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, reckless_force_counter(15), ignition_mages_fuse(3)
4:19.367 default O moonfire Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(15), ignition_mages_fuse(4)
4:20.334 default Q lunar_strike Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(16), ignition_mages_fuse(4)
4:21.564 default R solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, reckless_force_counter(16), ignition_mages_fuse(4)
4:22.531 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(16), ignition_mages_fuse(5)
4:23.462 default N sunfire Fluffy_Pillow 65.5/100: 66% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(16), ignition_mages_fuse(5)
4:24.272 default P stellar_flare Fluffy_Pillow 69.0/100: 69% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(17), ignition_mages_fuse(5)
4:25.082 default R solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(17), ignition_mages_fuse(5)
4:25.837 default S sunfire Fluffy_Pillow 86.0/100: 86% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(17), ignition_mages_fuse(5)
4:26.647 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power celestial_alignment, lunar_empowerment(2), torrent_of_elements, reckless_force_counter(17)
4:27.723 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(18)
4:28.613 default M moonfire Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, reckless_force_counter(19)
4:29.660 default Q lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar, lunar_empowerment(3), starlord, torrent_of_elements, reckless_force_counter(19)
4:31.192 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar, lunar_empowerment(2), starlord, torrent_of_elements, reckless_force_counter(19)
4:32.395 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, reckless_force_counter(19)
4:33.886 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), reckless_force_counter(19)
4:35.055 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(19)
4:36.501 default H the_unbound_force Fluffy_Pillow 27.0/100: 27% astral_power reckless_force, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:37.636 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power reckless_force, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:39.084 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power reckless_force, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
4:40.220 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
4:41.187 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:42.634 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter
4:44.082 default N sunfire Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), reckless_force_counter
4:45.219 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), reckless_force_counter(2)
4:46.186 default P stellar_flare Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), reckless_force_counter(2)
4:47.322 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(4), solar_empowerment, reckless_force_counter(2)
4:48.560 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, reckless_force_counter(2)
4:50.090 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, reckless_force_counter(3)
4:51.111 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(4)
4:52.313 default O moonfire Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(4)
4:53.481 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(5)
4:54.969 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25), reckless_force_counter(5)
4:56.331 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(23), reckless_force_counter(6)
4:57.247 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(22), reckless_force_counter(6)
4:58.327 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), reckless_force_counter(6)
4:59.669 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(20), reckless_force_counter(7)
5:00.568 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(19), reckless_force_counter(7)
5:01.920 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(18), reckless_force_counter(7)
5:02.984 default N sunfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), reckless_force_counter(7)
5:04.054 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), reckless_force_counter(7)
5:05.424 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(14), reckless_force_counter(9)
5:06.342 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(13), reckless_force_counter(9)
5:07.264 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(12), reckless_force_counter(10)
5:08.352 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(8), lunar_empowerment, overwhelming_power(11), reckless_force_counter(11)
5:09.542 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(10), reckless_force_counter(11)
5:10.400 default P stellar_flare Fluffy_Pillow 38.5/100: 39% astral_power celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(9), reckless_force_counter(11), conch_of_dark_whispers
5:11.413 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(8), reckless_force_counter(12), conch_of_dark_whispers
5:12.428 default R solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(7), reckless_force_counter(12), conch_of_dark_whispers
5:13.270 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(6), reckless_force_counter(13), conch_of_dark_whispers
5:14.536 default M moonfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(5), reckless_force_counter(13), conch_of_dark_whispers
5:15.535 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, lunar_empowerment(2), starlord(2), overwhelming_power(4), reckless_force_counter(13), conch_of_dark_whispers
5:17.002 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(2), reckless_force_counter(13), conch_of_dark_whispers
5:18.161 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power, reckless_force_counter(13), conch_of_dark_whispers
5:19.603 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(14), conch_of_dark_whispers
5:21.051 default N sunfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(14), conch_of_dark_whispers
5:22.187 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(14), conch_of_dark_whispers
5:23.324 default Q lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(14), conch_of_dark_whispers
5:24.773 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(14), conch_of_dark_whispers
5:25.739 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(14)
5:27.187 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), reckless_force_counter(15)
5:28.072 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, overwhelming_power(23), reckless_force_counter(15), conch_of_dark_whispers
5:29.119 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(3), lunar_empowerment, torrent_of_elements, overwhelming_power(22), reckless_force_counter(15), conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="unbound force"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

visions : 45782 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
45781.8 45781.8 32.0 / 0.070% 7691.4 / 16.8% 5297.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.6 8.5 Astral Power 0.00% 59.5 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
visions 45782
Heed My Call 313 (447) 0.7% (1.0%) 8.4 32.40sec 15916 0 Direct 8.4 9223 18436 11144 20.9%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.43 8.43 0.00 0.00 0.0000 0.0000 93936.54 93936.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.67 79.15% 9222.96 9012 9913 9221.25 0 9913 61528 61528 0.00
crit 1.76 20.85% 18436.32 18024 19826 15368.52 0 19826 32408 32408 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 134 0.3% 8.4 32.40sec 4772 0 Direct 8.4 3953 7901 4772 20.7%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.43 8.43 0.00 0.00 0.0000 0.0000 40223.38 40223.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.68 79.25% 3952.70 3862 4248 3952.60 0 4248 26404 26404 0.00
crit 1.75 20.75% 7901.26 7725 8497 6572.17 0 8497 13819 13819 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6298 13.7% 79.8 3.67sec 23632 18528 Direct 79.8 19534 39372 23632 20.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.84 79.84 0.00 0.00 1.2755 0.0000 1886804.29 1886804.29 0.00 18527.69 18527.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.35 79.34% 19533.73 10238 24458 19533.35 18663 20631 1237405 1237405 0.00
crit 16.49 20.66% 39372.20 20477 48917 39382.82 34742 44770 649400 649400 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3059 6.7% 14.3 21.21sec 64243 64269 Direct 14.3 3343 6663 4012 20.2%  
Periodic 228.1 3109 6270 3766 20.8% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.26 14.26 228.10 228.10 0.9996 1.3047 916344.61 916344.61 0.00 2938.36 64268.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.39 79.85% 3342.71 3012 4107 3342.61 3059 3657 38070 38070 0.00
crit 2.87 20.15% 6663.39 6024 8213 6377.34 0 8213 19156 19156 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.7 79.21% 3109.30 2 3823 3109.26 3004 3256 561742 561742 0.00
crit 47.4 20.79% 6269.62 4 7647 6270.20 5822 6773 297377 297377 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 984 2.1% 45.5 6.42sec 6480 0 Direct 45.5 5347 10773 6480 20.9%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.49 45.49 0.00 0.00 0.0000 0.0000 294806.64 294806.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.99 79.12% 5346.87 4818 6569 5346.81 4976 5784 192455 192455 0.00
crit 9.50 20.88% 10772.62 9636 13139 10768.60 0 12741 102351 102351 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3483 (5625) 7.6% (12.3%) 95.5 3.09sec 17647 20056 Direct 96.1 8975 18103 10865 20.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.53 96.06 0.00 0.00 0.8799 0.0000 1043690.56 1043690.56 0.00 20056.38 20056.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.16 79.29% 8974.67 8030 10949 8975.40 8589 9623 683514 683514 0.00
crit 19.90 20.71% 18103.26 16060 21898 18107.37 16450 20384 360177 360177 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2142 4.7% 78.3 3.75sec 8198 0 Direct 78.3 8198 0 8198 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.32 78.32 0.00 0.00 0.0000 0.0000 642048.07 642048.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.32 100.00% 8198.17 6023 16423 8200.26 7024 9531 642048 642048 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6022.59
  • base_dd_max:6022.59
  • base_dd_mult:1.00
 
Starsurge 15025 32.8% 64.8 4.67sec 69516 67941 Direct 64.5 57664 116229 69775 20.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.76 64.52 0.00 0.00 1.0232 0.0000 4502043.04 4502043.04 0.00 67941.01 67941.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.18 79.32% 57664.03 51872 70323 57655.50 54569 60850 2951234 2951234 0.00
crit 13.34 20.68% 116228.87 103744 140646 116241.37 103744 133820 1550809 1550809 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1986 4.3% 12.8 23.57sec 46511 45584 Direct 12.8 2846 5675 3423 20.4%  
Periodic 225.7 2015 4063 2442 20.9% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.79 12.79 225.67 225.67 1.0203 1.3075 594959.44 594959.44 0.00 1930.99 45583.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.18 79.61% 2846.48 2596 3540 2846.54 2615 3199 28988 28988 0.00
crit 2.61 20.39% 5674.54 5193 7081 5373.36 0 7081 14799 14799 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 178.6 79.14% 2015.19 4 2478 2015.14 1947 2116 359879 359879 0.00
crit 47.1 20.86% 4062.72 173 4956 4063.08 3840 4399 191293 191293 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 8960 19.6% 133.7 2.15sec 20124 0 Direct 133.7 16568 33109 20124 21.5%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 133.66 133.66 0.00 0.00 0.0000 0.0000 2689839.81 2689839.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.93 78.50% 16568.02 16184 17803 16567.28 16184 17533 1738409 1738409 0.00
crit 28.74 21.50% 33109.34 32369 35606 33106.80 32369 35126 951430 951430 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3398 7.4% 18.0 16.67sec 56646 56656 Direct 18.0 4628 9258 5544 19.8%  
Periodic 227.2 3340 6731 4042 20.7% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.98 17.98 227.23 227.23 0.9998 1.3056 1018221.18 1018221.18 0.00 3236.02 56655.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.42 80.21% 4627.68 4154 5664 4626.92 4249 5023 66722 66722 0.00
crit 3.56 19.79% 9258.32 8309 11329 9071.85 0 11329 32932 32932 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.1 79.28% 3339.75 2 4107 3339.71 3217 3512 601641 601641 0.00
crit 47.1 20.72% 6730.59 4 8213 6731.12 6301 7291 316925 316925 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
visions
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Berserking 2.0 190.54sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.5 149.54sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.46 0.00 0.00 0.00 0.9046 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.6 56.9 42.1sec 4.7sec 93.22% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.14%
  • arcanic_pulsar_2:10.74%
  • arcanic_pulsar_3:11.61%
  • arcanic_pulsar_4:11.09%
  • arcanic_pulsar_5:13.02%
  • arcanic_pulsar_6:10.91%
  • arcanic_pulsar_7:11.13%
  • arcanic_pulsar_8:13.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 110.5sec 0.0sec 16.23% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 190.9sec 190.9sec 8.12% 7.97% 0.0(0.0) 2.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 10.0 0.0 31.0sec 31.0sec 39.46% 47.21% 0.0(0.0) 9.5

Buff details

  • buff initial source:visions
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:39.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.0sec 45.6sec 23.65% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.4 0.0 149.6sec 149.6sec 15.73% 0.00% 2.3(2.3) 2.3

Buff details

  • buff initial source:visions
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.23%
  • ignition_mages_fuse_2:3.19%
  • ignition_mages_fuse_3:3.15%
  • ignition_mages_fuse_4:3.10%
  • ignition_mages_fuse_5:3.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 29.4 54.6 10.2sec 3.6sec 85.67% 98.91% 3.3(3.3) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:32.47%
  • lunar_empowerment_2:32.70%
  • lunar_empowerment_3:20.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 399.2(399.2) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.6 63.9sec 33.1sec 48.82% 0.00% 3.6(50.8) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.39%
  • overwhelming_power_2:1.43%
  • overwhelming_power_3:1.47%
  • overwhelming_power_4:1.51%
  • overwhelming_power_5:1.55%
  • overwhelming_power_6:1.60%
  • overwhelming_power_7:1.64%
  • overwhelming_power_8:1.69%
  • overwhelming_power_9:1.74%
  • overwhelming_power_10:1.79%
  • overwhelming_power_11:1.84%
  • overwhelming_power_12:1.90%
  • overwhelming_power_13:1.96%
  • overwhelming_power_14:2.01%
  • overwhelming_power_15:2.07%
  • overwhelming_power_16:2.14%
  • overwhelming_power_17:2.20%
  • overwhelming_power_18:2.27%
  • overwhelming_power_19:2.34%
  • overwhelming_power_20:2.42%
  • overwhelming_power_21:2.49%
  • overwhelming_power_22:2.57%
  • overwhelming_power_23:2.66%
  • overwhelming_power_24:2.73%
  • overwhelming_power_25:1.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 28.3 52.5 10.5sec 3.7sec 84.58% 81.61% 0.3(0.3) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:30.58%
  • solar_empowerment_2:37.97%
  • solar_empowerment_3:16.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.4 49.4 20.1sec 4.7sec 98.00% 93.09% 19.0(19.0) 10.7

Buff details

  • buff initial source:visions
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:13.91%
  • starlord_2:21.87%
  • starlord_3:62.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.8sec 45.3sec 23.75% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:visions
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.75%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Vision of Perfection 4.1 0.6 60.8sec 51.1sec 14.21% 0.00% 0.6(0.6) 3.9

Buff details

  • buff initial source:visions
  • cooldown name:buff_vision_of_perfection
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:123.79

Stack Uptimes

  • vision_of_perfection_1:14.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:303344
  • name:Vision of Perfection
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc303342=When Vision of Perfection activates, you and {$s1=2} other nearby allies gain {$s2=0} Haste for {$303344d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
visions
starsurge Astral Power 64.8 2590.5 40.0 40.0 1737.9
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 96.53 771.68 (30.21%) 7.99 0.52 0.07%
celestial_alignment Astral Power 2.46 98.24 (3.85%) 40.00 0.00 0.00%
sunfire Astral Power 17.97 53.92 (2.11%) 3.00 0.00 0.00%
shooting_stars Astral Power 45.49 181.94 (7.12%) 4.00 0.04 0.02%
moonfire Astral Power 14.26 42.79 (1.68%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.79 102.31 (4.01%) 8.00 0.02 0.02%
lunar_strike Astral Power 79.84 957.55 (37.49%) 11.99 0.53 0.06%
natures_balance Astral Power 400.21 200.09 (7.83%) 0.50 0.01 0.01%
arcanic_pulsar Astral Power 6.73 80.71 (3.16%) 12.00 0.00 0.00%
vision_of_perfection Astral Power 4.65 64.93 (2.54%) 13.97 0.13 0.20%
Resource RPS-Gain RPS-Loss
Astral Power 8.52 8.64
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.44 0.00 99.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data visions Fight Length
Count 14412
Mean 299.78
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data visions Damage Per Second
Count 14412
Mean 45781.79
Minimum 38886.23
Maximum 55119.11
Spread ( max - min ) 16232.88
Range [ ( max - min ) / 2 * 100% ] 17.73%
Standard Deviation 1962.1250
5th Percentile 42798.79
95th Percentile 49197.82
( 95th Percentile - 5th Percentile ) 6399.03
Mean Distribution
Standard Deviation 16.3442
95.00% Confidence Intervall ( 45749.75 - 45813.82 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 71
0.1% Error 7057
0.1 Scale Factor Error with Delta=300 32866
0.05 Scale Factor Error with Delta=300 131462
0.01 Scale Factor Error with Delta=300 3286526
Priority Target DPS
Sample Data visions Priority Target Damage Per Second
Count 14412
Mean 45781.79
Minimum 38886.23
Maximum 55119.11
Spread ( max - min ) 16232.88
Range [ ( max - min ) / 2 * 100% ] 17.73%
Standard Deviation 1962.1250
5th Percentile 42798.79
95th Percentile 49197.82
( 95th Percentile - 5th Percentile ) 6399.03
Mean Distribution
Standard Deviation 16.3442
95.00% Confidence Intervall ( 45749.75 - 45813.82 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 71
0.1% Error 7057
0.1 Scale Factor Error with Delta=300 32866
0.05 Scale Factor Error with Delta=300 131462
0.01 Scale Factor Error with Delta=300 3286526
DPS(e)
Sample Data visions Damage Per Second (Effective)
Count 14412
Mean 45781.79
Minimum 38886.23
Maximum 55119.11
Spread ( max - min ) 16232.88
Range [ ( max - min ) / 2 * 100% ] 17.73%
Damage
Sample Data visions Damage
Count 14412
Mean 13722917.55
Minimum 10143470.74
Maximum 18485376.61
Spread ( max - min ) 8341905.87
Range [ ( max - min ) / 2 * 100% ] 30.39%
DTPS
Sample Data visions Damage Taken Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data visions Healing Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data visions Healing Per Second (Effective)
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data visions Heal
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data visions Healing Taken Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data visions Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data visionsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data visions Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.45 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.46 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 3.74 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 64.76 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 3.65 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 3.13 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 13.72 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
N 11.14 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.79 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 80.17 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 95.77 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.60 sunfire

Sample Sequence

0123456789ACDJNMOHFGJQJQPQJQPQPJQMQPNQPQJOQPJPJPPPQQQJQJMQPQPLQIJJPPJOQPPJMQPPQQQJNPJPQJMOEQPQPQPIJQJQJQLPPJMPPOQQQQJJPPPJMNQPJQPPQQOQJPJMQPJQLPQJPQQQQQJMOPJPQNHGJQJQPQPQPMJQJQPQOJQPJQPQJQPQLPMPJPPJPQQJOPQJFNMQPQPKJPJPQQPJQPJQOQLPQMQQJJPQPPQJQPQPQJMNOQPJQPJQPJQPMPQQQNQOIJQJQJQKPPJPQJQPQPQLPJPJMOQPJQPPHGJQPQRIJNQPJQPJOQPJQPQJQPQPQRLJJQPJQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask visions 58.0/100: 58% astral_power
Pre precombat 1 food visions 58.0/100: 58% astral_power
Pre precombat 2 augmentation visions 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.240 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.164 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.090 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.015 default H celestial_alignment Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.823 default F berserking Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.823 default G use_items Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.823 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:05.578 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:06.333 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.089 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:07.842 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.687 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.443 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.198 default Q solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.953 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.763 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.518 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.327 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.082 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.838 default M sunfire Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.592 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.348 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.127 default N moonfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.884 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.638 default P lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.461 default Q solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.217 default J starsurge Fluffy_Pillow 99.0/100: 99% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.972 default O stellar_flare Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.727 default Q solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.482 default P lunar_strike Fluffy_Pillow 76.5/100: 77% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.321 default J starsurge Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, ignition_mages_fuse(5)
0:24.075 default P lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), ignition_mages_fuse(5)
0:25.014 default J starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2)
0:25.913 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3)
0:27.028 default P lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:28.142 default P lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
0:29.257 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3)
0:30.012 default Q solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3)
0:30.766 default Q solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3)
0:31.642 default J starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3)
0:32.517 default Q solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
0:33.273 default J starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3)
0:34.034 default M sunfire Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
0:34.795 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
0:35.548 default P lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3)
0:36.517 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
0:37.269 default P lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3)
0:38.238 default L moonfire Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3)
0:38.999 default Q solar_wrath Fluffy_Pillow 85.5/100: 86% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(3)
0:39.876 default I cancel_buff Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(3)
0:39.876 default J starsurge Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, arcanic_pulsar, lunar_empowerment
0:40.828 default J starsurge Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord
0:41.754 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2)
0:43.243 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
0:44.732 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2)
0:45.901 default O stellar_flare Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:47.038 default Q solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:48.005 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3)
0:49.453 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:50.901 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
0:52.037 default M sunfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:53.175 default Q solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:54.140 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:55.588 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
0:57.036 default Q solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3)
0:58.003 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3)
0:58.969 default Q solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(5), starlord(3)
1:00.106 default J starsurge Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(5)
1:01.344 default N moonfire Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord
1:02.546 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord
1:04.077 default J starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(6), solar_empowerment, starlord
1:05.279 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2)
1:06.768 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:07.761 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), conch_of_dark_whispers
1:08.929 default M sunfire Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:10.066 default O stellar_flare Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:11.200 default E potion Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), vision_of_perfection, conch_of_dark_whispers
1:11.200 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:12.030 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:13.270 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), celestial_alignment, solar_empowerment, starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:14.100 default P lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(8), celestial_alignment, starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:15.559 default Q solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(8), celestial_alignment, starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:16.533 default P lunar_strike Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(8), celestial_alignment, starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:17.993 default I cancel_buff Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(8), starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:17.993 default J starsurge Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(8), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:19.213 default Q solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:20.090 default J starsurge Fluffy_Pillow 76.0/100: 76% astral_power celestial_alignment, lunar_empowerment, starlord, vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:21.120 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect
1:21.984 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), battle_potion_of_intellect
1:23.001 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
1:23.842 default L moonfire Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect
1:24.830 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), battle_potion_of_intellect
1:26.277 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), battle_potion_of_intellect
1:27.725 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
1:28.862 default M sunfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
1:29.997 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
1:31.444 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
1:32.890 default O stellar_flare Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
1:34.028 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
1:34.996 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, battle_potion_of_intellect
1:36.132 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, battle_potion_of_intellect
1:37.269 default Q solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements
1:38.405 default J starsurge Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(3), lunar_empowerment, torrent_of_elements
1:39.643 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(24)
1:40.746 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(23)
1:42.118 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21)
1:43.498 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(20)
1:44.883 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(19)
1:45.975 default M sunfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(18)
1:47.039 default N moonfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(16)
1:48.113 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(15)
1:49.029 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14)
1:50.404 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(13)
1:51.488 default Q solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(12)
1:52.413 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11)
1:53.803 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10)
1:55.197 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(8)
1:56.137 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(7)
1:57.079 default O stellar_flare Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(6)
1:58.192 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(5)
1:59.306 default J starsurge Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(7), overwhelming_power(4)
2:00.527 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(3)
2:02.040 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), solar_empowerment, starlord, overwhelming_power
2:03.236 default M sunfire Fluffy_Pillow 17.0/100: 17% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2)
2:04.252 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2)
2:05.116 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2)
2:06.409 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power celestial_alignment, solar_empowerment, starlord(2)
2:07.426 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
2:08.265 default L moonfire Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
2:09.252 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3)
2:10.700 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, solar_empowerment, starlord(3)
2:11.667 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, starlord(3)
2:12.805 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3)
2:14.252 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3)
2:15.219 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(2), starlord(3)
2:16.354 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(2), starlord(3)
2:17.490 default Q solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), starlord(3)
2:18.626 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(2), starlord(3)
2:19.762 default J starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(2)
2:21.000 default M sunfire Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord
2:22.202 default O stellar_flare Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord
2:23.404 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
2:24.936 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(3), solar_empowerment, starlord, conch_of_dark_whispers
2:26.138 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:27.628 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(25), conch_of_dark_whispers
2:28.536 default N moonfire Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), overwhelming_power(24), conch_of_dark_whispers
2:29.609 default H celestial_alignment Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(4), celestial_alignment, solar_empowerment, starlord(2), overwhelming_power(23), conch_of_dark_whispers
2:30.546 default G use_items Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(4), celestial_alignment, solar_empowerment, starlord(2), overwhelming_power(22), conch_of_dark_whispers
2:30.546 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(4), celestial_alignment, solar_empowerment, starlord(2), overwhelming_power(22), conch_of_dark_whispers, ignition_mages_fuse
2:31.449 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers, ignition_mages_fuse
2:32.204 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(20), conch_of_dark_whispers, ignition_mages_fuse
2:33.086 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse
2:33.839 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse
2:34.968 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18), conch_of_dark_whispers, ignition_mages_fuse(2)
2:35.721 default P lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse(2)
2:36.814 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(6), celestial_alignment, starlord(3), overwhelming_power(16), conch_of_dark_whispers, ignition_mages_fuse(2)
2:37.676 default P lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(6), celestial_alignment, starlord(3), overwhelming_power(15), conch_of_dark_whispers, ignition_mages_fuse(2)
2:38.970 default M sunfire Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(6), celestial_alignment, starlord(3), overwhelming_power(14), conch_of_dark_whispers, ignition_mages_fuse(3)
2:39.806 default J starsurge Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(6), celestial_alignment, overwhelming_power(13), conch_of_dark_whispers, ignition_mages_fuse(3)
2:40.719 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(12), conch_of_dark_whispers, ignition_mages_fuse(3)
2:41.476 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord, overwhelming_power(11), conch_of_dark_whispers, ignition_mages_fuse(3)
2:42.368 default Q solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(10), conch_of_dark_whispers, ignition_mages_fuse(3)
2:43.124 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(25), conch_of_dark_whispers, ignition_mages_fuse(4)
2:44.142 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(24), conch_of_dark_whispers, ignition_mages_fuse(4)
2:44.944 default O stellar_flare Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(24), conch_of_dark_whispers, ignition_mages_fuse(4)
2:45.746 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(23), conch_of_dark_whispers, ignition_mages_fuse(4)
2:46.551 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), ignition_mages_fuse(5)
2:47.306 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(21), ignition_mages_fuse(5)
2:48.278 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(20), ignition_mages_fuse(5)
2:49.042 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), ignition_mages_fuse(5)
2:49.796 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(19), ignition_mages_fuse(5)
2:50.774 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(18)
2:51.563 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(17)
2:52.492 default Q solar_wrath Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(16)
2:53.287 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(15)
2:54.481 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(14)
2:55.280 default L moonfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(13)
2:56.222 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), overwhelming_power(12)
2:57.607 default M sunfire Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(11)
2:58.697 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(10)
3:00.091 default J starsurge Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(2), lunar_empowerment, overwhelming_power(8)
3:01.294 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(7)
3:02.788 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(25)
3:04.187 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), solar_empowerment, starlord, overwhelming_power(23)
3:05.296 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22)
3:06.670 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(21)
3:07.592 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), overwhelming_power(20)
3:08.518 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(4), starlord(2), overwhelming_power(19)
3:09.612 default O stellar_flare Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18)
3:10.675 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17), conch_of_dark_whispers
3:12.035 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(15), conch_of_dark_whispers
3:12.951 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(25), conch_of_dark_whispers
3:13.991 default F berserking Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24), vision_of_perfection, conch_of_dark_whispers
3:13.991 default N moonfire Fluffy_Pillow 15.0/100: 15% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24), vision_of_perfection, conch_of_dark_whispers
3:14.803 default M sunfire Fluffy_Pillow 18.5/100: 19% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), vision_of_perfection, conch_of_dark_whispers
3:15.620 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(22), vision_of_perfection, conch_of_dark_whispers
3:16.374 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(21), vision_of_perfection, conch_of_dark_whispers
3:17.421 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power berserking, arcanic_pulsar(6), celestial_alignment, starlord(3), overwhelming_power(20), vision_of_perfection, conch_of_dark_whispers
3:18.246 default P lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power berserking, arcanic_pulsar(6), celestial_alignment, starlord(3), overwhelming_power(19), vision_of_perfection, conch_of_dark_whispers
3:19.488 default K sunfire Fluffy_Pillow 68.5/100: 69% astral_power berserking, arcanic_pulsar(6), celestial_alignment, starlord(3), overwhelming_power(18), vision_of_perfection, conch_of_dark_whispers
3:20.317 default J starsurge Fluffy_Pillow 72.5/100: 73% astral_power berserking, arcanic_pulsar(6), overwhelming_power(17), vision_of_perfection, conch_of_dark_whispers
3:21.360 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power berserking, arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(16), vision_of_perfection, conch_of_dark_whispers
3:22.657 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power berserking, arcanic_pulsar(7), solar_empowerment, starlord, overwhelming_power(15), vision_of_perfection, conch_of_dark_whispers
3:23.678 default P lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power berserking, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(14), conch_of_dark_whispers
3:24.963 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power berserking, arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(13), conch_of_dark_whispers
3:25.825 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power berserking, arcanic_pulsar(8), solar_empowerment, starlord(2), overwhelming_power(12), conch_of_dark_whispers
3:26.688 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(2), overwhelming_power(11), conch_of_dark_whispers
3:28.116 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(8), starlord(2), overwhelming_power(24), conch_of_dark_whispers
3:29.190 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers
3:29.964 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers
3:31.124 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power celestial_alignment, starlord(3), overwhelming_power(21), conch_of_dark_whispers
3:32.039 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(20), conch_of_dark_whispers
3:32.822 default O stellar_flare Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(20), conch_of_dark_whispers
3:33.743 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(19), conch_of_dark_whispers
3:34.667 default L moonfire Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(18), conch_of_dark_whispers
3:35.592 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17)
3:36.953 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(16)
3:38.024 default M sunfire Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(25)
3:39.065 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(24)
3:40.106 default Q solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(23)
3:41.153 default J starsurge Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar, lunar_empowerment, torrent_of_elements, overwhelming_power(22)
3:42.298 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(21)
3:43.411 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(20)
3:44.795 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(19)
3:45.723 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(18)
3:47.117 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(16)
3:48.520 default Q solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(15)
3:49.460 default J starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(14)
3:50.570 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(13)
3:51.489 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12)
3:52.875 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(11)
3:53.801 default P lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10)
3:55.197 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(8)
3:56.134 default J starsurge Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7)
3:57.241 default M sunfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(6)
3:58.353 default N moonfire Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(5)
3:59.469 default O stellar_flare Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(4)
4:00.589 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(3)
4:01.544 default P lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), torrent_of_elements, overwhelming_power(2)
4:03.109 default J starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2)
4:04.347 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord
4:05.369 default P lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(25)
4:06.770 default J starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(24)
4:07.872 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(23)
4:08.789 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(22)
4:10.163 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(20)
4:11.251 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(19)
4:12.154 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18)
4:13.511 default M sunfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17)
4:14.580 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16)
4:15.948 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15)
4:16.864 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14)
4:17.780 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(13)
4:18.865 default N moonfire Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(12)
4:19.952 default Q solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(11)
4:21.044 default O stellar_flare Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(9)
4:22.143 default I cancel_buff Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(8)
4:22.143 default J starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(8), torrent_of_elements, overwhelming_power(8)
4:23.345 default Q solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(7)
4:24.212 default J starsurge Fluffy_Pillow 77.0/100: 77% astral_power celestial_alignment, lunar_empowerment, starlord, torrent_of_elements, overwhelming_power(6)
4:25.236 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(5)
4:26.082 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(4)
4:27.084 default Q solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(3)
4:27.915 default K sunfire Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(3)
4:28.892 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), overwhelming_power(2)
4:30.330 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3)
4:31.779 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3)
4:32.916 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:34.362 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), vision_of_perfection
4:35.189 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), vision_of_perfection
4:36.163 default Q solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), vision_of_perfection
4:36.994 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), vision_of_perfection
4:38.234 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), vision_of_perfection
4:39.062 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), vision_of_perfection
4:40.304 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), vision_of_perfection
4:41.132 default L moonfire Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), vision_of_perfection
4:42.106 default P lunar_strike Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(4), lunar_empowerment(2), starlord(3), vision_of_perfection
4:43.534 default J starsurge Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(4), lunar_empowerment, vision_of_perfection
4:44.754 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord
4:46.284 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord
4:47.487 default M sunfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2)
4:48.657 default O stellar_flare Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2)
4:49.828 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2)
4:50.822 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2)
4:52.312 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2)
4:53.480 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3)
4:54.447 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
4:55.894 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
4:57.342 default H celestial_alignment Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
4:58.331 default G use_items Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
4:58.331 default J starsurge Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse
4:59.281 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse
5:00.087 default P lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse
5:01.291 default Q solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse
5:02.095 default R sunfire Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse
5:03.040 default I cancel_buff Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
5:03.040 default J starsurge Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment(2), torrent_of_elements, ignition_mages_fuse(2)
5:04.031 default N moonfire Fluffy_Pillow 61.5/100: 62% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord, torrent_of_elements, ignition_mages_fuse(2)
5:04.992 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord, torrent_of_elements, ignition_mages_fuse(2)
5:05.809 default P lunar_strike Fluffy_Pillow 81.5/100: 82% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, ignition_mages_fuse(2)
5:07.034 default J starsurge Fluffy_Pillow 94.5/100: 95% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, ignition_mages_fuse(3)
5:07.957 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, ignition_mages_fuse(3)
5:08.720 default P lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), ignition_mages_fuse(3)
5:09.864 default J starsurge Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse(3)
5:10.762 default O stellar_flare Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse(4)
5:11.601 default Q solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse(4)
5:12.355 default P lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25), ignition_mages_fuse(4)
5:13.345 default J starsurge Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), ignition_mages_fuse(4)
5:14.125 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23), ignition_mages_fuse(4)
5:14.880 default P lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), ignition_mages_fuse(5)
5:15.843 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(22), ignition_mages_fuse(5)
5:16.599 default J starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), ignition_mages_fuse(5)
5:17.361 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20), ignition_mages_fuse(5)
5:18.116 default P lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse(5)
5:19.090 default Q solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers
5:19.876 default P lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18), conch_of_dark_whispers
5:21.058 default Q solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(4), celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(16), conch_of_dark_whispers
5:21.853 default R sunfire Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(4), celestial_alignment, starlord(3), overwhelming_power(16), conch_of_dark_whispers
5:22.787 default L moonfire Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(4), celestial_alignment, starlord(3), overwhelming_power(15), conch_of_dark_whispers
5:23.723 default J starsurge Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar(4), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers
5:24.900 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers
5:26.047 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(11), vision_of_perfection, conch_of_dark_whispers
5:26.866 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(11), vision_of_perfection, conch_of_dark_whispers
5:28.093 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(9), vision_of_perfection, conch_of_dark_whispers
5:29.062 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8), vision_of_perfection, conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 5.88% 5.88% 500
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="visions"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

worldvein : 41924 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
41924.3 41924.3 22.3 / 0.053% 5297.0 / 12.6% 5146.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 8.0 Astral Power 0.00% 58.4 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
worldvein 41924
Heed My Call 303 (433) 0.7% (1.0%) 8.2 33.05sec 15765 0 Direct 8.2 9127 18243 11036 20.9%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.23 8.23 0.00 0.00 0.0000 0.0000 90838.66 90838.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.51 79.07% 9127.45 8921 9813 9125.85 0 9813 59407 59407 0.00
crit 1.72 20.93% 18243.03 17842 19626 15038.16 0 19626 31432 31432 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 130 0.3% 8.2 33.05sec 4729 0 Direct 8.2 3912 7819 4730 20.9%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.23 8.23 0.00 0.00 0.0000 0.0000 38930.51 38930.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.51 79.07% 3911.74 3823 4206 3910.68 0 4206 25460 25460 0.00
crit 1.72 20.93% 7818.65 7646 8411 6464.63 0 8411 13470 13470 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6130 14.6% 76.8 3.80sec 23906 18416 Direct 76.8 19762 40214 23906 20.3%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.79 76.79 0.00 0.00 1.2981 0.0000 1835721.48 1835721.48 0.00 18416.15 18416.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.23 79.74% 19761.68 10135 25993 19769.00 18968 20878 1210021 1210021 0.00
crit 15.56 20.26% 40213.58 20270 51987 40247.10 36451 47821 625700 625700 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3038 7.3% 14.0 21.36sec 64791 64075 Direct 14.0 3410 6954 4135 20.5%  
Periodic 222.8 3136 6414 3819 20.8% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.03 14.03 222.84 222.84 1.0112 1.3310 909155.22 909155.22 0.00 2925.26 64074.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.16 79.55% 3410.18 2981 4364 3411.68 3122 3876 38064 38064 0.00
crit 2.87 20.45% 6953.61 5963 8729 6696.04 0 8729 19958 19958 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 176.4 79.16% 3136.41 2 4063 3137.68 3032 3287 553292 553292 0.00
crit 46.4 20.84% 6414.47 6 8127 6418.68 6006 7011 297841 297841 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 977 2.3% 44.5 6.59sec 6577 0 Direct 44.5 5391 11030 6577 21.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.48 44.48 0.00 0.00 0.0000 0.0000 292538.90 292538.90 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.13 78.98% 5390.92 4769 6982 5393.08 5050 5908 189383 189383 0.00
crit 9.35 21.02% 11030.03 9539 13963 11035.07 0 13724 103156 103156 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3406 (5456) 8.1% (13.0%) 92.3 3.18sec 17690 19757 Direct 92.8 9021 18448 10981 20.8%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.31 92.83 0.00 0.00 0.8954 0.0000 1019367.66 1019367.66 0.00 19757.43 19757.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.53 79.21% 9020.53 7949 11636 9025.16 8670 9542 663286 663286 0.00
crit 19.30 20.79% 18448.18 15898 23272 18464.91 16894 21090 356082 356082 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2050 4.9% 73.8 3.97sec 8310 0 Direct 73.8 8310 0 8310 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.84 73.84 0.00 0.00 0.0000 0.0000 613662.86 613662.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.84 100.00% 8310.47 5962 17454 8318.08 7157 9820 613663 613663 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6198.00
  • base_dd_max:6198.00
  • base_dd_mult:1.00
 
Starsurge 14391 34.3% 60.9 4.95sec 70694 67813 Direct 60.7 57888 118899 70917 21.4%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.91 60.72 0.00 0.00 1.0425 0.0000 4305892.48 4305892.48 0.00 67812.53 67812.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.75 78.64% 57888.43 51347 74359 57907.99 55314 60965 2764192 2764192 0.00
crit 12.97 21.36% 118898.53 102695 148718 119038.16 104569 138984 1541701 1541701 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1973 4.7% 12.7 23.57sec 46324 45171 Direct 12.7 2856 5858 3534 22.6%  
Periodic 220.3 2032 4156 2475 20.9% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.75 12.75 220.34 220.34 1.0256 1.3346 590476.81 590476.81 0.00 1922.40 45171.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.87 77.43% 2856.07 2570 3762 2855.58 2621 3145 28188 28188 0.00
crit 2.88 22.57% 5858.21 5140 7525 5644.07 0 7525 16854 16854 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 174.4 79.13% 2031.98 3 2634 2032.81 1955 2149 354280 354280 0.00
crit 46.0 20.87% 4156.23 14 5267 4159.14 3903 4508 191154 191154 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6144 14.6% 89.7 3.10sec 20382 0 Direct 89.7 16390 32752 20381 24.4%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.72 89.72 0.00 0.00 0.0000 0.0000 1828657.74 1828657.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.84 75.61% 16390.27 16021 17623 16390.09 16021 17539 1111854 1111854 0.00
crit 21.89 24.39% 32752.50 32042 35246 32752.73 32042 35032 716804 716804 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3382 8.1% 18.0 16.54sec 56138 55188 Direct 18.0 4696 9458 5619 19.4%  
Periodic 222.0 3368 6891 4104 20.9% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.03 18.03 221.96 221.96 1.0173 1.3323 1012261.43 1012261.43 0.00 3223.10 55188.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.54 80.61% 4695.93 4112 6020 4696.09 4383 5111 68259 68259 0.00
crit 3.50 19.39% 9457.94 8225 12040 9253.98 0 12040 33063 33063 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 175.6 79.11% 3368.43 2 4364 3369.82 3258 3525 591510 591510 0.00
crit 46.4 20.89% 6890.70 4 8729 6895.42 6461 7473 319429 319429 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
worldvein
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.57sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.70sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9025 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Worldvein Resonance 5.5 60.36sec

Stats details: worldvein_resonance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 0.00 0.00 0.00 1.1410 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: worldvein_resonance

Static Values
  • id:295186
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295186
  • name:Worldvein Resonance
  • school:physical
  • tooltip:
  • description:Concentrate energy into the Heart of Azeroth, immediately causing {$s1=2} Lifeblood Shards to erupt from the nearby ground for {$295114d=12 seconds}. $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within {$295078s2=8} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 53.6 44.3sec 5.0sec 92.81% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.55%
  • arcanic_pulsar_2:10.34%
  • arcanic_pulsar_3:10.98%
  • arcanic_pulsar_4:10.71%
  • arcanic_pulsar_5:13.83%
  • arcanic_pulsar_6:10.61%
  • arcanic_pulsar_7:10.76%
  • arcanic_pulsar_8:14.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 188.7sec 0.0sec 16.23% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.12% 7.76% 0.0(0.0) 2.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.5sec 37.5sec 25.85% 32.62% 0.0(0.0) 8.1

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.8sec 45.4sec 23.73% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.17% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.89%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lifeblood 29.0 0.0 40.0sec 10.4sec 94.51% 0.00% 6.7(7.3) 5.1

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_lifeblood
  • max_stacks:4
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:229.17

Stack Uptimes

  • lifeblood_1:35.91%
  • lifeblood_2:19.91%
  • lifeblood_3:11.44%
  • lifeblood_4:27.24%

Trigger Attempt Success

  • trigger_pct:99.88%

Spelldata details

  • id:295137
  • name:Lifeblood
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by ${$w1+$w2+$w3}.
  • description:{$@spelldesc295078=Every {$s4=18}-{$s1=25} sec, a Lifeblood Shard erupts from the nearby ground for {$295114d=12 seconds}.$?!s295186&a295078[ $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within ${$m2*(1+($295160m1/100))} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.][]}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.1 45.6 8.9sec 3.8sec 81.75% 99.68% 1.9(1.9) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.36%
  • lunar_empowerment_2:31.52%
  • lunar_empowerment_3:13.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 399.2(399.2) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.5 64.3sec 33.9sec 47.97% 0.00% 3.5(47.9) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.04%
  • overwhelming_power_16:2.10%
  • overwhelming_power_17:2.16%
  • overwhelming_power_18:2.23%
  • overwhelming_power_19:2.29%
  • overwhelming_power_20:2.36%
  • overwhelming_power_21:2.44%
  • overwhelming_power_22:2.51%
  • overwhelming_power_23:2.59%
  • overwhelming_power_24:2.66%
  • overwhelming_power_25:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 24.5 51.6 12.1sec 3.9sec 85.49% 79.66% 0.3(0.3) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.03%
  • solar_empowerment_2:39.60%
  • solar_empowerment_3:17.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.7 20.3sec 4.9sec 97.05% 92.03% 15.8(15.8) 11.3

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.78%
  • starlord_2:22.31%
  • starlord_3:59.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 61.2sec 45.8sec 23.51% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.51%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
worldvein
starsurge Astral Power 60.9 2436.4 40.0 40.0 1767.3
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 93.31 746.45 (31.11%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.33%) 40.00 0.00 0.00%
sunfire Astral Power 18.03 54.09 (2.25%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.48 177.92 (7.42%) 4.00 0.01 0.01%
moonfire Astral Power 14.03 42.10 (1.75%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.75 101.97 (4.25%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.79 921.43 (38.41%) 12.00 0.06 0.01%
natures_balance Astral Power 400.21 200.10 (8.34%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.25 74.95 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.00 8.13
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.34 0.00 69.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data worldvein Fight Length
Count 14412
Mean 299.78
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data worldvein Damage Per Second
Count 14412
Mean 41924.25
Minimum 37923.94
Maximum 47403.27
Spread ( max - min ) 9479.33
Range [ ( max - min ) / 2 * 100% ] 11.31%
Standard Deviation 1364.6816
5th Percentile 39782.19
95th Percentile 44245.73
( 95th Percentile - 5th Percentile ) 4463.54
Mean Distribution
Standard Deviation 11.3676
95.00% Confidence Intervall ( 41901.97 - 41946.53 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4071
0.1 Scale Factor Error with Delta=300 15899
0.05 Scale Factor Error with Delta=300 63593
0.01 Scale Factor Error with Delta=300 1589814
Priority Target DPS
Sample Data worldvein Priority Target Damage Per Second
Count 14412
Mean 41924.25
Minimum 37923.94
Maximum 47403.27
Spread ( max - min ) 9479.33
Range [ ( max - min ) / 2 * 100% ] 11.31%
Standard Deviation 1364.6816
5th Percentile 39782.19
95th Percentile 44245.73
( 95th Percentile - 5th Percentile ) 4463.54
Mean Distribution
Standard Deviation 11.3676
95.00% Confidence Intervall ( 41901.97 - 41946.53 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4071
0.1 Scale Factor Error with Delta=300 15899
0.05 Scale Factor Error with Delta=300 63593
0.01 Scale Factor Error with Delta=300 1589814
DPS(e)
Sample Data worldvein Damage Per Second (Effective)
Count 14412
Mean 41924.25
Minimum 37923.94
Maximum 47403.27
Spread ( max - min ) 9479.33
Range [ ( max - min ) / 2 * 100% ] 11.31%
Damage
Sample Data worldvein Damage
Count 14412
Mean 12537503.76
Minimum 9877579.96
Maximum 15560144.24
Spread ( max - min ) 5682564.29
Range [ ( max - min ) / 2 * 100% ] 22.66%
DTPS
Sample Data worldvein Damage Taken Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data worldvein Healing Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data worldvein Healing Per Second (Effective)
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data worldvein Heal
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data worldvein Healing Taken Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data worldvein Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data worldveinTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data worldvein Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
H 5.47 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.93 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.91 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.99 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.80 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.59 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.23 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.75 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 77.15 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 92.57 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.45 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRQKRQKRQRKRQNRQORQRSKPKRLQQKRQQRRRQKRKRQRQRJKKNOQPKRQQKRQQRRRHKNOQKQRRKPQRRQRQNKRKRQKMQQRKQPRNRRRKQKQORRKQRRRKNPQHRKQGRRORKRQKRQRLKQRRRQPKQKQRRONKQRQKQRRRRRKQKPNQRKORQRKLQHQQIEFKRKRQKPRQKORNRQKRQRQQKQRKQQNPKORQKRQRQRKQRKQNRRKQOPHKRQQGQKRQKNRQRQKQORRPRQRJKRKRKRQNQKQQRKOQRRKNPQRKQRRRKQHRRONRKQPQKRQKRQLRRKQRRRKQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask worldvein 58.0/100: 58% astral_power
Pre precombat 1 food worldvein 58.0/100: 58% astral_power
Pre precombat 2 augmentation worldvein 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H worldvein_resonance Fluffy_Pillow 66.0/100: 66% astral_power lunar_empowerment, battle_potion_of_intellect
0:01.237 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, lunar_empowerment, lifeblood(3), battle_potion_of_intellect
0:02.191 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:03.117 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:04.043 default P stellar_flare Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:04.969 default I celestial_alignment Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:05.775 default F berserking Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:05.775 default G use_items Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:05.775 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:06.529 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:07.284 default Q lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.152 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse
0:08.906 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(25), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse
0:09.661 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(24), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse
0:10.438 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.191 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.945 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.699 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.455 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(20), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.209 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(19), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.964 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(19), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.718 default N sunfire Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.472 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(17), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.227 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(16), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.980 default O moonfire Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(16), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.733 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(15), lifeblood(2), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.488 default Q lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(14), lifeblood(2), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.278 default R solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(13), lifeblood(2), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.032 default S sunfire Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(12), lifeblood(2), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.786 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, torrent_of_elements, overwhelming_power(12), lifeblood(2), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.539 default P stellar_flare Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(11), lifeblood(2), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.294 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(10), lifeblood(2), ignition_mages_fuse(5)
0:24.049 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(9), lifeblood(2), ignition_mages_fuse(5)
0:24.803 default L sunfire Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(9), lifeblood(2), ignition_mages_fuse(5)
0:25.557 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(8), lifeblood, ignition_mages_fuse(5)
0:26.474 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(7), lifeblood
0:27.591 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(25)
0:28.414 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(24)
0:29.170 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23)
0:30.196 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22)
0:31.226 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21)
0:31.982 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21)
0:32.737 default R solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(20), lifeblood
0:33.552 default Q lunar_strike Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), lifeblood
0:34.594 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(18), lifeblood
0:35.414 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17), lifeblood
0:36.168 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16), lifeblood
0:36.924 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(16), lifeblood
0:37.676 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(15), lifeblood
0:38.594 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(14), lifeblood(2)
0:39.349 default Q lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(13), lifeblood(2)
0:40.273 default R solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(12), lifeblood(2)
0:41.026 default J cancel_buff Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar, celestial_alignment, starlord(3), overwhelming_power(11), lifeblood(2)
0:41.026 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar, celestial_alignment, overwhelming_power(11), lifeblood(2)
0:42.062 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), lifeblood(2)
0:43.165 default N sunfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23), lifeblood(2)
0:44.242 default O moonfire Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(22), lifeblood(2)
0:45.321 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21), lifeblood(2)
0:46.700 default P stellar_flare Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(20), lifeblood(2)
0:47.788 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(19), lifeblood(2)
0:48.881 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(18), lifeblood(2)
0:49.787 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), lifeblood(3)
0:51.148 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), lifeblood(2)
0:52.518 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), lifeblood(2)
0:53.598 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(25), lifeblood(2)
0:54.480 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), lifeblood(2)
0:55.809 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), lifeblood(2), conch_of_dark_whispers
0:57.142 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), lifeblood, conch_of_dark_whispers
0:58.038 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), lifeblood, conch_of_dark_whispers
0:58.937 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, overwhelming_power(20), lifeblood, conch_of_dark_whispers
0:59.994 default H worldvein_resonance Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, overwhelming_power(19), lifeblood, conch_of_dark_whispers
1:01.064 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(5), torrent_of_elements, overwhelming_power(17), lifeblood(4), conch_of_dark_whispers
1:02.229 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(16), lifeblood(4), conch_of_dark_whispers
1:03.365 default O moonfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(15), lifeblood(4), conch_of_dark_whispers
1:04.503 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14), lifeblood(4), conch_of_dark_whispers
1:05.958 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(6), solar_empowerment, starlord, overwhelming_power(13), lifeblood(4), conch_of_dark_whispers
1:07.105 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(11), lifeblood(4), conch_of_dark_whispers
1:08.535 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(10), lifeblood(4), conch_of_dark_whispers
1:09.493 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), overwhelming_power(9), lifeblood(4), conch_of_dark_whispers
1:10.454 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), starlord(2), overwhelming_power(8), lifeblood(4), conch_of_dark_whispers
1:11.589 default P stellar_flare Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(7), lifeblood(4)
1:12.698 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(6), lifeblood(4)
1:14.113 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(4), lifeblood(4)
1:15.064 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(3), lifeblood(4)
1:16.189 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(2), lifeblood(4)
1:17.628 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power, lifeblood(4)
1:18.760 default Q lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), lifeblood
1:20.206 default N sunfire Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(8), starlord(3), lifeblood
1:21.343 default K starsurge Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(8), lifeblood(2)
1:22.582 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood
1:23.472 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power celestial_alignment, lunar_empowerment, starlord, lifeblood
1:24.518 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), lifeblood
1:25.382 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), lifeblood
1:26.678 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), lifeblood
1:27.694 default M moonfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood
1:28.681 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood
1:30.127 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), lifeblood
1:31.575 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), lifeblood
1:32.541 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(2), starlord(3), lifeblood
1:33.677 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), lifeblood
1:35.123 default P stellar_flare Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood
1:36.259 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood
1:37.227 default N sunfire Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, lifeblood
1:38.363 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, lifeblood
1:39.330 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, lifeblood
1:40.465 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, lifeblood
1:41.602 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(3), torrent_of_elements, lifeblood(2)
1:42.841 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, lifeblood(2)
1:44.371 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(4), solar_empowerment, starlord, torrent_of_elements, lifeblood(2)
1:45.576 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(2)
1:47.065 default O moonfire Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2), torrent_of_elements, lifeblood(2)
1:48.232 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2), torrent_of_elements, lifeblood(2)
1:49.228 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(2)
1:50.223 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), lifeblood(2)
1:51.392 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(3)
1:52.840 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), lifeblood(3)
1:53.807 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), lifeblood(3)
1:54.775 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(6), starlord(3), lifeblood(3)
1:55.913 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, lifeblood(3)
1:57.050 default N sunfire Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, lifeblood(2)
1:58.187 default P stellar_flare Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, lifeblood(2)
1:59.321 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, lifeblood(2)
2:00.769 default H worldvein_resonance Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, lifeblood
2:01.904 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(7), solar_empowerment, torrent_of_elements, lifeblood(4)
2:02.957 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(7), torrent_of_elements, lifeblood(4)
2:04.195 default Q lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, lifeblood(4)
2:05.724 default G use_items Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(8), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(25), lifeblood(4)
2:05.724 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(8), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(25), lifeblood(4), ignition_mages_fuse
2:06.622 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(8), starlord, torrent_of_elements, overwhelming_power(24), lifeblood(4), ignition_mages_fuse
2:07.683 default O moonfire Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(8), starlord, torrent_of_elements, overwhelming_power(23), lifeblood(4), ignition_mages_fuse
2:08.747 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(8), starlord, torrent_of_elements, overwhelming_power(22), lifeblood(4), ignition_mages_fuse
2:09.815 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), starlord, torrent_of_elements, overwhelming_power(21), lifeblood(4), ignition_mages_fuse(2)
2:10.845 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(25), lifeblood(4), ignition_mages_fuse(2)
2:11.601 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(24), lifeblood(4), ignition_mages_fuse(2)
2:12.700 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power celestial_alignment, starlord(2), overwhelming_power(23), lifeblood(4), ignition_mages_fuse(2)
2:13.565 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(22), lifeblood(4), ignition_mages_fuse(2)
2:14.318 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(25), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(3)
2:15.345 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, celestial_alignment, starlord(3), overwhelming_power(24), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.153 default L sunfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, celestial_alignment, starlord(3), overwhelming_power(23), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.965 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, starlord(3), overwhelming_power(23), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.898 default Q lunar_strike Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(22), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.047 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(20), lifeblood(2), conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.818 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(20), lifeblood, conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.588 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(19), lifeblood, conch_of_dark_whispers, ignition_mages_fuse(4)
2:21.500 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(18), lifeblood, conch_of_dark_whispers, ignition_mages_fuse(4)
2:22.663 default P stellar_flare Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(17), lifeblood, conch_of_dark_whispers, ignition_mages_fuse(5)
2:23.548 default K starsurge Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(2), overwhelming_power(25), lifeblood, conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.489 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), lifeblood, conch_of_dark_whispers, ignition_mages_fuse(5)
2:25.656 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(23), lifeblood, conch_of_dark_whispers, ignition_mages_fuse(5)
2:26.575 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(22), lifeblood, conch_of_dark_whispers
2:27.952 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(21), lifeblood, conch_of_dark_whispers
2:28.874 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(20), lifeblood, conch_of_dark_whispers
2:29.799 default O moonfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(4), starlord(2), torrent_of_elements, overwhelming_power(19), lifeblood, conch_of_dark_whispers
2:30.890 default N sunfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(4), starlord(2), torrent_of_elements, overwhelming_power(18), lifeblood, conch_of_dark_whispers
2:31.984 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), starlord(2), torrent_of_elements, overwhelming_power(17), lifeblood, conch_of_dark_whispers
2:33.082 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15), lifeblood, conch_of_dark_whispers
2:34.450 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), lifeblood(2), conch_of_dark_whispers
2:35.368 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), lifeblood(2), conch_of_dark_whispers
2:36.694 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), lifeblood, conch_of_dark_whispers
2:37.736 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), lifeblood
2:39.071 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), lifeblood
2:39.968 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), lifeblood
2:40.862 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(20), lifeblood
2:41.920 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(19), lifeblood
2:42.981 default R solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(18), lifeblood
2:44.046 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(6), lunar_empowerment, overwhelming_power(16), lifeblood
2:45.214 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(15), lifeblood
2:46.664 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(14), lifeblood
2:47.807 default P stellar_flare Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(13), lifeblood
2:48.922 default N sunfire Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(12), lifeblood
2:50.040 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(10), lifeblood
2:51.474 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(9), lifeblood
2:52.434 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(8)
2:53.568 default O moonfire Fluffy_Pillow 13.5/100: 14% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(7)
2:54.532 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(6), lifeblood
2:55.353 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5), lifeblood
2:56.588 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(4), lifeblood
2:57.418 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(3), lifeblood
2:58.396 default L sunfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2), lifeblood
2:59.377 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power, lifeblood
3:00.822 default H worldvein_resonance Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood
3:01.958 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4)
3:03.404 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
3:04.851 default I celestial_alignment Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, solar_empowerment(2), lifeblood(4)
3:06.047 default E potion Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(2), lifeblood(4)
3:06.047 default F berserking Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(2), lifeblood(4), battle_potion_of_intellect
3:06.047 default K starsurge Fluffy_Pillow 96.0/100: 96% astral_power berserking, arcanic_pulsar, celestial_alignment, solar_empowerment(2), lifeblood(4), battle_potion_of_intellect
3:07.028 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, lifeblood(4), battle_potion_of_intellect
3:07.839 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, lifeblood(4), battle_potion_of_intellect
3:08.790 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), lifeblood(4), battle_potion_of_intellect
3:09.577 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(4), battle_potion_of_intellect
3:10.756 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(4), battle_potion_of_intellect
3:11.679 default P stellar_flare Fluffy_Pillow 7.5/100: 8% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), lifeblood(4), battle_potion_of_intellect
3:12.578 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), lifeblood(4), battle_potion_of_intellect
3:13.344 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect
3:14.488 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect
3:15.388 default O moonfire Fluffy_Pillow 2.0/100: 2% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), lifeblood(4), battle_potion_of_intellect
3:16.287 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), lifeblood(4), battle_potion_of_intellect
3:17.051 default N sunfire Fluffy_Pillow 14.0/100: 14% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect
3:17.950 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect
3:18.715 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect
3:19.974 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood, battle_potion_of_intellect
3:20.962 default R solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:21.803 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
3:23.062 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood, battle_potion_of_intellect
3:23.903 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood, battle_potion_of_intellect
3:25.162 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), lifeblood(2), battle_potion_of_intellect
3:26.610 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(6), lifeblood(2), battle_potion_of_intellect
3:27.851 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, lifeblood(2), battle_potion_of_intellect
3:29.381 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), solar_empowerment, starlord, lifeblood(2), battle_potion_of_intellect
3:30.402 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), lunar_empowerment, starlord, torrent_of_elements, lifeblood(2), battle_potion_of_intellect
3:31.605 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, lifeblood(2)
3:33.093 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(24), lifeblood(2)
3:34.458 default N sunfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(23), lifeblood(3)
3:35.534 default P stellar_flare Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(22), lifeblood(3)
3:36.615 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(21), lifeblood(3)
3:37.697 default O moonfire Fluffy_Pillow 18.0/100: 18% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), lifeblood(3)
3:38.618 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), lifeblood(3)
3:39.404 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18), lifeblood(3)
3:40.585 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17), lifeblood(3)
3:41.514 default R solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), lifeblood(2)
3:42.307 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15), lifeblood(2)
3:43.500 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14), lifeblood
3:44.416 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(13), lifeblood
3:45.796 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(12), lifeblood
3:46.883 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar, torrent_of_elements, overwhelming_power(11), lifeblood
3:48.072 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(9), lifeblood, conch_of_dark_whispers
3:49.554 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(2), solar_empowerment, starlord, overwhelming_power(8), lifeblood, conch_of_dark_whispers
3:50.545 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(2), starlord, overwhelming_power(7), lifeblood(2), conch_of_dark_whispers
3:51.717 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(6), lifeblood(2), conch_of_dark_whispers
3:53.172 default N sunfire Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), overwhelming_power(24), lifeblood(2), conch_of_dark_whispers
3:54.244 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), overwhelming_power(23), lifeblood(2), conch_of_dark_whispers
3:55.159 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(3), starlord(2), overwhelming_power(22), lifeblood(2), conch_of_dark_whispers
3:56.239 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(2), overwhelming_power(21), lifeblood(2), conch_of_dark_whispers
3:57.322 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(20), lifeblood(2), conch_of_dark_whispers
3:58.667 default O moonfire Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25), lifeblood(2), conch_of_dark_whispers
3:59.706 default P stellar_flare Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), lifeblood(2), conch_of_dark_whispers
4:00.750 default H worldvein_resonance Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), lifeblood(2), conch_of_dark_whispers
4:01.869 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), lifeblood(4), conch_of_dark_whispers
4:02.918 default R solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(21), lifeblood(4)
4:03.813 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(20), lifeblood(4)
4:05.162 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), lifeblood(4)
4:06.519 default G use_items Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), lifeblood(4)
4:06.519 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), lifeblood(4), ignition_mages_fuse
4:07.826 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), solar_empowerment(2), overwhelming_power(16), lifeblood(4), ignition_mages_fuse
4:08.947 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(15), lifeblood(4), ignition_mages_fuse
4:09.876 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(14), lifeblood(4), ignition_mages_fuse
4:11.273 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord, overwhelming_power(12), lifeblood(4), ignition_mages_fuse(2)
4:12.336 default N sunfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(11), lifeblood(4), ignition_mages_fuse(2)
4:13.371 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(10), lifeblood(4), ignition_mages_fuse(2)
4:14.254 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(9), lifeblood(4), ignition_mages_fuse(2)
4:15.581 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(8), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(3)
4:16.435 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(7), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.718 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), overwhelming_power(6), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(3)
4:18.729 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(4)
4:19.940 default O moonfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(4), lifeblood, conch_of_dark_whispers, ignition_mages_fuse(4)
4:20.894 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(3), lifeblood, conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.708 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(2), lifeblood, conch_of_dark_whispers, ignition_mages_fuse(4)
4:22.523 default P stellar_flare Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power, lifeblood, conch_of_dark_whispers, ignition_mages_fuse(5)
4:23.451 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(8), starlord(3), lifeblood, conch_of_dark_whispers, ignition_mages_fuse(5)
4:24.380 default Q lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), lifeblood, conch_of_dark_whispers, ignition_mages_fuse(5)
4:25.566 default R solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(8), starlord(3), lifeblood, conch_of_dark_whispers, ignition_mages_fuse(5)
4:26.496 default J cancel_buff Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(8), starlord(3), lifeblood, conch_of_dark_whispers, ignition_mages_fuse(5)
4:26.496 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(8), lifeblood, conch_of_dark_whispers, ignition_mages_fuse(5)
4:27.510 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood, conch_of_dark_whispers
4:28.398 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power celestial_alignment, lunar_empowerment, starlord, lifeblood(2), conch_of_dark_whispers
4:29.444 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), lifeblood, conch_of_dark_whispers
4:30.309 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), lifeblood, conch_of_dark_whispers
4:31.326 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood, conch_of_dark_whispers
4:32.166 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), lifeblood, conch_of_dark_whispers
4:33.426 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), lifeblood, conch_of_dark_whispers
4:34.565 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), lifeblood, conch_of_dark_whispers
4:36.012 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), lifeblood, conch_of_dark_whispers
4:37.149 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood, conch_of_dark_whispers
4:38.596 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), lifeblood, conch_of_dark_whispers
4:40.044 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), lifeblood, conch_of_dark_whispers
4:41.010 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(3), starlord(3), lifeblood, conch_of_dark_whispers
4:42.146 default O moonfire Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), lifeblood, conch_of_dark_whispers
4:43.282 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, lifeblood, conch_of_dark_whispers
4:44.730 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(2)
4:45.695 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), starlord(3), torrent_of_elements, lifeblood(2)
4:46.834 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), torrent_of_elements, lifeblood(2)
4:48.073 default N sunfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, lifeblood(2)
4:49.277 default P stellar_flare Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, lifeblood(2)
4:50.480 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, lifeblood(2)
4:52.012 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, torrent_of_elements, lifeblood(2)
4:53.034 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), solar_empowerment, starlord, torrent_of_elements, lifeblood(2)
4:54.237 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(2)
4:55.727 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(2)
4:56.720 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), torrent_of_elements, lifeblood(2)
4:57.714 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(6), starlord(2), torrent_of_elements, lifeblood(2)
4:58.883 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), starlord(2), overwhelming_power(24), lifeblood(2)
4:59.958 default Q lunar_strike Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), lifeblood(2)
5:01.291 default H worldvein_resonance Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(21), lifeblood(2)
5:02.345 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(20), lifeblood(4)
5:03.246 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(19), lifeblood(4)
5:04.308 default O moonfire Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(18), lifeblood(3)
5:05.373 default N sunfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(17), lifeblood(3)
5:06.442 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(16), lifeblood(3)
5:07.514 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(7), lunar_empowerment, overwhelming_power(15), lifeblood(3)
5:08.687 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(14), lifeblood(3)
5:10.142 default P stellar_flare Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(12), lifeblood(3)
5:11.293 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(11), lifeblood(4)
5:12.765 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(8), solar_empowerment, starlord, overwhelming_power(10), lifeblood(4)
5:13.925 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(9), lifeblood(4)
5:14.763 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(8), lifeblood(4)
5:16.021 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power celestial_alignment, solar_empowerment(2), starlord(2), overwhelming_power(6), lifeblood(4)
5:17.016 default R solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(5), lifeblood(4)
5:17.843 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5), lifeblood(4)
5:19.078 default L sunfire Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(3), lifeblood(4)
5:20.055 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(2), lifeblood
5:21.013 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power, lifeblood
5:21.974 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, starlord(3), overwhelming_power, lifeblood
5:23.108 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), lifeblood
5:24.556 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), lifeblood
5:25.522 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(2), starlord(3), lifeblood
5:26.659 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(2), starlord(3), lifeblood
5:27.796 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(2), lifeblood
5:29.033 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="worldvein"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

Simulation & Raid Information

Iterations: 14418
Threads: 6
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 299.8 )

Performance:

Total Events Processed: 329536850
Max Event Queue: 320
Sim Seconds: 4322285
CPU Seconds: 422.9844
Physical Seconds: 78.3742
Speed Up: 10219

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
base base augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
base base berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.70sec 0 299.78sec
base base celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.53sec 0 299.78sec
base base flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
base base food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
base base heed_my_call 271685 90699 303 1.65 9128 18244 8.2 8.2 20.8% 0.0% 0.0% 0.0% 33.14sec 90699 299.78sec
base base heed_my_call_aoe 271686 38927 130 1.65 3912 7820 8.2 8.2 21.0% 0.0% 0.0% 0.0% 33.14sec 38927 299.78sec
base base lunar_strike 194153 1800687 6007 15.69 18971 38568 78.4 78.4 20.4% 0.0% 0.0% 0.0% 3.73sec 1800687 299.78sec
base base moonfire 8921 55688 186 2.81 3276 6654 14.1 14.1 20.3% 0.0% 0.0% 0.0% 21.42sec 876695 299.78sec
base base moonfire ticks -8921 821007 2737 44.78 3010 6145 14.1 223.9 21.0% 0.0% 0.0% 0.0% 21.42sec 876695 299.78sec
base base moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
base base potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
base base shooting_stars 202497 281038 937 8.93 5174 10565 44.6 44.6 20.9% 0.0% 0.0% 0.0% 6.57sec 281038 299.78sec
base base solar_wrath 190984 1012757 3378 19.23 8652 17653 95.6 96.1 21.0% 0.0% 0.0% 0.0% 3.09sec 1012757 299.78sec
base base solar_empowerment 279729 601934 2008 15.10 7980 0 75.4 75.4 0.0% 0.0% 0.0% 0.0% 3.89sec 601934 299.78sec
base base starsurge 78674 4203572 14022 12.39 55750 113788 62.1 61.9 21.0% 0.0% 0.0% 0.0% 4.88sec 4203572 299.78sec
base base stellar_flare 202347 43054 144 2.56 2779 5665 12.8 12.8 20.3% 0.0% 0.0% 0.0% 23.57sec 569390 299.78sec
base base stellar_flare ticks -202347 526335 1754 44.30 1951 3982 12.8 221.5 21.0% 0.0% 0.0% 0.0% 23.57sec 569390 299.78sec
base base streaking_stars 272873 1857804 6197 18.19 16390 32745 90.9 90.9 24.8% 0.0% 0.0% 0.0% 3.08sec 1857804 299.78sec
base base sunfire 93402 95850 320 3.55 4491 9069 17.8 17.8 19.8% 0.0% 0.0% 0.0% 16.87sec 973743 299.78sec
base base sunfire ticks -93402 877893 2926 44.61 3233 6596 17.8 223.1 20.9% 0.0% 0.0% 0.0% 16.87sec 973743 299.78sec
blood of the enemy blood of the enemy augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
blood of the enemy blood of the enemy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.69sec 0 299.78sec
blood of the enemy blood of the enemy blood_of_the_enemy 297108 132016 440 0.74 27660 69236 3.7 3.7 19.8% 0.0% 0.0% 0.0% 91.14sec 132016 299.78sec
blood of the enemy blood of the enemy celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.57sec 0 299.78sec
blood of the enemy blood of the enemy flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
blood of the enemy blood of the enemy food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
blood of the enemy blood of the enemy heed_my_call 271685 94554 315 1.66 9129 18752 8.3 8.3 23.3% 0.0% 0.0% 0.0% 32.62sec 94554 299.78sec
blood of the enemy blood of the enemy heed_my_call_aoe 271686 40543 135 1.66 3913 8033 8.3 8.3 23.4% 0.0% 0.0% 0.0% 32.62sec 40543 299.78sec
blood of the enemy blood of the enemy lunar_strike 194153 1828290 6099 15.62 18962 38931 78.0 78.0 22.4% 0.0% 0.0% 0.0% 3.74sec 1828290 299.78sec
blood of the enemy blood of the enemy moonfire 8921 57136 191 2.81 3274 6788 14.0 14.0 22.6% 0.0% 0.0% 0.0% 21.44sec 911792 299.78sec
blood of the enemy blood of the enemy moonfire ticks -8921 854655 2849 45.24 3009 6321 14.0 226.2 23.2% 0.0% 0.0% 0.0% 21.44sec 911792 299.78sec
blood of the enemy blood of the enemy moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
blood of the enemy blood of the enemy potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
blood of the enemy blood of the enemy shooting_stars 202497 292727 976 9.02 5172 10856 45.1 45.1 23.2% 0.0% 0.0% 0.0% 6.49sec 292727 299.78sec
blood of the enemy blood of the enemy solar_wrath 190984 1027167 3426 19.12 8642 17818 95.0 95.5 23.0% 0.0% 0.0% 0.0% 3.10sec 1027167 299.78sec
blood of the enemy blood of the enemy solar_empowerment 279729 612062 2042 15.03 8152 0 75.1 75.1 0.0% 0.0% 0.0% 0.0% 3.90sec 612062 299.78sec
blood of the enemy blood of the enemy starsurge 78674 4333931 14457 12.35 55688 117664 61.9 61.7 23.5% 0.0% 0.0% 0.0% 4.88sec 4333931 299.78sec
blood of the enemy blood of the enemy stellar_flare 202347 44500 148 2.56 2776 5887 12.8 12.8 22.6% 0.0% 0.0% 0.0% 23.57sec 593105 299.78sec
blood of the enemy blood of the enemy stellar_flare ticks -202347 548606 1829 44.78 1950 4098 12.8 223.9 23.3% 0.0% 0.0% 0.0% 23.57sec 593105 299.78sec
blood of the enemy blood of the enemy streaking_stars 272873 1902504 6346 17.99 16391 34155 89.9 89.9 26.9% 0.0% 0.0% 0.0% 3.11sec 1902504 299.78sec
blood of the enemy blood of the enemy sunfire 93402 99171 331 3.57 4485 9284 17.8 17.8 22.3% 0.0% 0.0% 0.0% 16.77sec 1012134 299.78sec
blood of the enemy blood of the enemy sunfire ticks -93402 912963 3043 45.07 3232 6774 17.8 225.3 23.1% 0.0% 0.0% 0.0% 16.77sec 1012134 299.78sec
focusing iris focusing iris augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
focusing iris focusing iris berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.64sec 0 299.78sec
focusing iris focusing iris celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.46sec 0 299.78sec
focusing iris focusing iris flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
focusing iris focusing iris food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
focusing iris focusing iris heed_my_call 271685 94901 317 1.72 9127 18252 8.6 8.6 20.9% 0.0% 0.0% 0.0% 32.01sec 94901 299.78sec
focusing iris focusing iris heed_my_call_aoe 271686 40685 136 1.72 3912 7820 8.6 8.6 21.0% 0.0% 0.0% 0.0% 32.01sec 40685 299.78sec
focusing iris focusing iris lunar_strike 194153 1875858 6257 16.32 18977 38634 81.6 81.6 20.5% 0.0% 0.0% 0.0% 3.60sec 1875858 299.78sec
focusing iris focusing iris moonfire 8921 55855 186 2.84 3262 6628 14.2 14.2 20.1% 0.0% 0.0% 0.0% 21.29sec 913341 299.78sec
focusing iris focusing iris moonfire ticks -8921 857486 2858 46.70 3013 6152 14.2 233.5 21.0% 0.0% 0.0% 0.0% 21.29sec 913341 299.78sec
focusing iris focusing iris moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
focusing iris focusing iris potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
focusing iris focusing iris shooting_stars 202497 293743 980 9.32 5178 10569 46.6 46.6 20.9% 0.0% 0.0% 0.0% 6.28sec 293743 299.78sec
focusing iris focusing iris solar_wrath 190984 1068957 3566 20.28 8665 17676 100.8 101.3 20.9% 0.0% 0.0% 0.0% 2.92sec 1068957 299.78sec
focusing iris focusing iris solar_empowerment 279729 625927 2088 15.69 7984 0 78.4 78.4 0.0% 0.0% 0.0% 0.0% 3.74sec 625927 299.78sec
focusing iris focusing iris starsurge 78674 4354644 14526 12.85 55811 113711 64.4 64.2 20.8% 0.0% 0.0% 0.0% 4.70sec 4354644 299.78sec
focusing iris focusing iris stellar_flare 202347 43118 144 2.56 2780 5662 12.8 12.8 20.4% 0.0% 0.0% 0.0% 23.56sec 592819 299.78sec
focusing iris focusing iris stellar_flare ticks -202347 549701 1832 46.22 1952 3985 12.8 231.1 21.0% 0.0% 0.0% 0.0% 23.56sec 592819 299.78sec
focusing iris focusing iris streaking_stars 272873 1930663 6440 18.90 16389 32745 94.4 94.4 24.8% 0.0% 0.0% 0.0% 2.99sec 1930663 299.78sec
focusing iris focusing iris sunfire 93402 94643 316 3.53 4492 9040 17.6 17.6 19.3% 0.0% 0.0% 0.0% 17.01sec 1011188 299.78sec
focusing iris focusing iris sunfire ticks -93402 916545 3055 46.52 3236 6605 17.6 232.6 20.9% 0.0% 0.0% 0.0% 17.01sec 1011188 299.78sec
lucid dreams lucid dreams augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
lucid dreams lucid dreams berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.11sec 0 299.78sec
lucid dreams lucid dreams celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.50sec 0 299.78sec
lucid dreams lucid dreams flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
lucid dreams lucid dreams food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
lucid dreams lucid dreams heed_my_call 271685 92518 309 1.66 9229 18453 8.3 8.3 21.0% 0.0% 0.0% 0.0% 33.03sec 92518 299.78sec
lucid dreams lucid dreams heed_my_call_aoe 271686 39575 132 1.66 3955 7912 8.3 8.3 20.7% 0.0% 0.0% 0.0% 33.03sec 39575 299.78sec
lucid dreams lucid dreams lunar_strike 194153 1782533 5946 15.40 19202 38848 76.9 76.9 20.2% 0.0% 0.0% 0.0% 3.80sec 1782533 299.78sec
lucid dreams lucid dreams memory_of_lucid_dreams 298357 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.06sec 0 299.78sec
lucid dreams lucid dreams moonfire 8921 56029 187 2.84 3280 6636 14.2 14.2 19.9% 0.0% 0.0% 0.0% 21.23sec 890235 299.78sec
lucid dreams lucid dreams moonfire ticks -8921 834206 2781 44.91 3058 6214 14.2 224.5 20.8% 0.0% 0.0% 0.0% 21.23sec 890235 299.78sec
lucid dreams lucid dreams moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
lucid dreams lucid dreams potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
lucid dreams lucid dreams shooting_stars 202497 286084 954 8.97 5255 10679 44.8 44.8 20.8% 0.0% 0.0% 0.0% 6.53sec 286084 299.78sec
lucid dreams lucid dreams solar_wrath 190984 916031 3056 17.17 8808 17889 85.1 85.8 20.6% 0.0% 0.0% 0.0% 3.44sec 916031 299.78sec
lucid dreams lucid dreams solar_empowerment 279729 651312 2173 16.21 8042 0 81.0 81.0 0.0% 0.0% 0.0% 0.0% 3.61sec 651312 299.78sec
lucid dreams lucid dreams starsurge 78674 5002005 16685 14.50 56663 115444 72.8 72.5 21.1% 0.0% 0.0% 0.0% 4.17sec 5002005 299.78sec
lucid dreams lucid dreams stellar_flare 202347 43522 145 2.56 2807 5692 12.8 12.8 20.7% 0.0% 0.0% 0.0% 23.58sec 578716 299.78sec
lucid dreams lucid dreams stellar_flare ticks -202347 535193 1784 44.44 1982 4030 12.8 222.2 20.8% 0.0% 0.0% 0.0% 23.58sec 578716 299.78sec
lucid dreams lucid dreams streaking_stars 272873 2002701 6680 19.58 16615 33211 97.9 97.9 23.2% 0.0% 0.0% 0.0% 2.88sec 2002701 299.78sec
lucid dreams lucid dreams sunfire 93402 95612 319 3.49 4560 9206 17.5 17.5 19.7% 0.0% 0.0% 0.0% 17.15sec 987898 299.78sec
lucid dreams lucid dreams sunfire ticks -93402 892286 2974 44.75 3282 6673 17.5 223.7 20.8% 0.0% 0.0% 0.0% 17.15sec 987898 299.78sec
purification protocol purification protocol augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
purification protocol purification protocol berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.55sec 0 299.78sec
purification protocol purification protocol celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.65sec 0 299.78sec
purification protocol purification protocol flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
purification protocol purification protocol food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
purification protocol purification protocol heed_my_call 271685 90216 301 1.64 9129 18257 8.2 8.2 20.9% 0.0% 0.0% 0.0% 33.48sec 90216 299.78sec
purification protocol purification protocol heed_my_call_aoe 271686 38639 129 1.64 3912 7824 8.2 8.2 20.9% 0.0% 0.0% 0.0% 33.48sec 38639 299.78sec
purification protocol purification protocol lunar_strike 194153 1762503 5879 15.37 18997 38551 76.8 76.8 20.2% 0.0% 0.0% 0.0% 3.80sec 1762503 299.78sec
purification protocol purification protocol moonfire 8921 55598 185 2.81 3269 6646 14.0 14.0 20.4% 0.0% 0.0% 0.0% 21.37sec 871777 299.78sec
purification protocol purification protocol moonfire ticks -8921 816179 2721 44.57 3008 6135 14.0 222.9 20.9% 0.0% 0.0% 0.0% 21.37sec 871777 299.78sec
purification protocol purification protocol moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
purification protocol purification protocol potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
purification protocol purification protocol purification_protocol 295293 225967 754 3.33 11227 22450 16.6 16.6 21.0% 0.0% 0.0% 0.0% 17.36sec 225967 299.78sec
purification protocol purification protocol purifying_blast 295337 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.37sec 0 299.78sec
purification protocol purification protocol purifying_tick ticks -295293 249420 831 0.00 5476 10946 37.9 0.0 20.1% 0.0% 0.0% 0.0% 7.63sec 249420 299.78sec
purification protocol purification protocol shooting_stars 202497 279780 933 8.90 5172 10545 44.4 44.4 20.9% 0.0% 0.0% 0.0% 6.54sec 279780 299.78sec
purification protocol purification protocol solar_wrath 190984 978401 3264 18.58 8663 17657 92.3 92.9 20.8% 0.0% 0.0% 0.0% 3.18sec 978401 299.78sec
purification protocol purification protocol solar_empowerment 279729 588508 1963 14.79 7962 0 73.9 73.9 0.0% 0.0% 0.0% 0.0% 3.96sec 588508 299.78sec
purification protocol purification protocol starsurge 78674 4140233 13811 12.15 55703 113956 60.9 60.7 21.4% 0.0% 0.0% 0.0% 4.95sec 4140233 299.78sec
purification protocol purification protocol stellar_flare 202347 43209 144 2.55 2751 5608 12.7 12.7 22.4% 0.0% 0.0% 0.0% 23.57sec 565945 299.78sec
purification protocol purification protocol stellar_flare ticks -202347 522736 1742 44.07 1950 3974 12.7 220.4 20.9% 0.0% 0.0% 0.0% 23.57sec 565945 299.78sec
purification protocol purification protocol streaking_stars 272873 1828815 6100 17.96 16391 32751 89.7 89.7 24.4% 0.0% 0.0% 0.0% 3.09sec 1828815 299.78sec
purification protocol purification protocol sunfire 93402 97122 324 3.61 4497 9058 18.0 18.0 19.4% 0.0% 0.0% 0.0% 16.53sec 970151 299.78sec
purification protocol purification protocol sunfire ticks -93402 873029 2910 44.40 3232 6589 18.0 222.0 20.9% 0.0% 0.0% 0.0% 16.53sec 970151 299.78sec
ripple in space ripple in space augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
ripple in space ripple in space berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.54sec 0 299.78sec
ripple in space ripple in space celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.65sec 0 299.78sec
ripple in space ripple in space flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
ripple in space ripple in space food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
ripple in space ripple in space heed_my_call 271685 91055 304 1.65 9131 18243 8.2 8.2 21.0% 0.0% 0.0% 0.0% 33.04sec 91055 299.78sec
ripple in space ripple in space heed_my_call_aoe 271686 39018 130 1.65 3912 7823 8.2 8.2 21.0% 0.0% 0.0% 0.0% 33.04sec 39018 299.78sec
ripple in space ripple in space lunar_strike 194153 1806125 6025 15.35 19451 39655 76.7 76.7 20.3% 0.0% 0.0% 0.0% 3.81sec 1806125 299.78sec
ripple in space ripple in space moonfire 8921 57220 191 2.81 3365 6869 14.0 14.0 20.3% 0.0% 0.0% 0.0% 21.37sec 895091 299.78sec
ripple in space ripple in space moonfire ticks -8921 837872 2793 44.57 3085 6324 14.0 222.8 20.8% 0.0% 0.0% 0.0% 21.37sec 895091 299.78sec
ripple in space ripple in space moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
ripple in space ripple in space potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
ripple in space ripple in space ripple_in_space 302731 125511 419 1.09 23093 0 5.5 5.4 0.0% 0.0% 0.0% 0.0% 60.37sec 125511 299.78sec
ripple in space ripple in space shooting_stars 202497 287713 960 8.90 5304 10869 44.5 44.5 20.9% 0.0% 0.0% 0.0% 6.56sec 287713 299.78sec
ripple in space ripple in space solar_wrath 190984 1008463 3364 18.61 8898 18230 92.4 93.0 20.9% 0.0% 0.0% 0.0% 3.18sec 1008463 299.78sec
ripple in space ripple in space solar_empowerment 279729 605997 2021 14.80 8197 0 73.9 73.9 0.0% 0.0% 0.0% 0.0% 3.96sec 605997 299.78sec
ripple in space ripple in space starsurge 78674 4239788 14143 12.15 56939 117241 60.9 60.7 21.4% 0.0% 0.0% 0.0% 4.95sec 4239788 299.78sec
ripple in space ripple in space stellar_flare 202347 44275 148 2.55 2802 5778 12.7 12.7 22.6% 0.0% 0.0% 0.0% 23.57sec 581052 299.78sec
ripple in space ripple in space stellar_flare ticks -202347 536777 1789 44.07 1999 4097 12.7 220.4 20.8% 0.0% 0.0% 0.0% 23.57sec 581052 299.78sec
ripple in space ripple in space streaking_stars 272873 1827970 6098 17.96 16392 32756 89.7 89.7 24.3% 0.0% 0.0% 0.0% 3.10sec 1827970 299.78sec
ripple in space ripple in space sunfire 93402 99760 333 3.61 4623 9324 18.0 18.0 19.3% 0.0% 0.0% 0.0% 16.52sec 996287 299.78sec
ripple in space ripple in space sunfire ticks -93402 896527 2988 44.40 3314 6794 18.0 222.0 20.8% 0.0% 0.0% 0.0% 16.52sec 996287 299.78sec
unbound force unbound force augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
unbound force unbound force berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.59sec 0 299.78sec
unbound force unbound force celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.66sec 0 299.78sec
unbound force unbound force flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
unbound force unbound force food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
unbound force unbound force heed_my_call 271685 93412 312 1.64 9127 18255 8.2 8.2 24.6% 0.0% 0.0% 0.0% 32.96sec 93412 299.78sec
unbound force unbound force heed_my_call_aoe 271686 39986 133 1.64 3912 7822 8.2 8.2 24.5% 0.0% 0.0% 0.0% 32.96sec 39986 299.78sec
unbound force unbound force lunar_strike 194153 1796869 5994 15.39 18992 38410 76.9 76.9 22.6% 0.0% 0.0% 0.0% 3.80sec 1796869 299.78sec
unbound force unbound force moonfire 8921 57096 190 2.81 3271 6611 14.0 14.0 24.0% 0.0% 0.0% 0.0% 21.38sec 896138 299.78sec
unbound force unbound force moonfire ticks -8921 839042 2797 44.59 3011 6104 14.0 222.9 24.3% 0.0% 0.0% 0.0% 21.38sec 896138 299.78sec
unbound force unbound force moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
unbound force unbound force potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
unbound force unbound force shooting_stars 202497 289016 964 8.92 5177 10494 44.6 44.6 24.6% 0.0% 0.0% 0.0% 6.55sec 289016 299.78sec
unbound force unbound force solar_wrath 190984 1002151 3343 18.70 8659 17599 92.9 93.4 23.1% 0.0% 0.0% 0.0% 3.16sec 1002151 299.78sec
unbound force unbound force solar_empowerment 279729 600495 2003 14.82 8109 0 74.1 74.1 0.0% 0.0% 0.0% 0.0% 3.95sec 600495 299.78sec
unbound force unbound force starsurge 78674 4242572 14152 12.18 55713 113494 61.1 60.9 24.2% 0.0% 0.0% 0.0% 4.94sec 4242572 299.78sec
unbound force unbound force stellar_flare 202347 44344 148 2.55 2755 5598 12.7 12.7 25.5% 0.0% 0.0% 0.0% 23.57sec 581342 299.78sec
unbound force unbound force stellar_flare ticks -202347 536998 1790 44.09 1951 3957 12.7 220.5 24.2% 0.0% 0.0% 0.0% 23.57sec 581342 299.78sec
unbound force unbound force streaking_stars 272873 1846627 6160 17.85 16391 32756 89.2 89.2 26.3% 0.0% 0.0% 0.0% 3.11sec 1846627 299.78sec
unbound force unbound force sunfire 93402 99937 333 3.61 4502 9017 18.0 18.0 22.9% 0.0% 0.0% 0.0% 16.49sec 997379 299.78sec
unbound force unbound force sunfire ticks -93402 897442 2991 44.41 3234 6558 18.0 222.1 24.3% 0.0% 0.0% 0.0% 16.49sec 997379 299.78sec
unbound force unbound force the_unbound_force ticks -298452 396303 1321 7.74 1593 8206 4.9 38.7 77.1% 0.0% 0.0% 0.0% 68.36sec 396303 299.78sec
visions visions augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
visions visions berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 190.54sec 0 299.78sec
visions visions celestial_alignment 194223 0 0 0.00 0 0 2.5 0.0 0.0% 0.0% 0.0% 0.0% 149.54sec 0 299.78sec
visions visions flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
visions visions food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
visions visions heed_my_call 271685 93937 313 1.69 9223 18436 8.4 8.4 20.9% 0.0% 0.0% 0.0% 32.40sec 93937 299.78sec
visions visions heed_my_call_aoe 271686 40223 134 1.69 3953 7901 8.4 8.4 20.7% 0.0% 0.0% 0.0% 32.40sec 40223 299.78sec
visions visions lunar_strike 194153 1886804 6294 15.98 19534 39372 79.8 79.8 20.7% 0.0% 0.0% 0.0% 3.67sec 1886804 299.78sec
visions visions moonfire 8921 57226 191 2.85 3343 6663 14.3 14.3 20.2% 0.0% 0.0% 0.0% 21.21sec 916345 299.78sec
visions visions moonfire ticks -8921 859119 2864 45.62 3109 6270 14.3 228.1 20.8% 0.0% 0.0% 0.0% 21.21sec 916345 299.78sec
visions visions moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
visions visions potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
visions visions shooting_stars 202497 294807 983 9.11 5347 10773 45.5 45.5 20.9% 0.0% 0.0% 0.0% 6.42sec 294807 299.78sec
visions visions solar_wrath 190984 1043691 3481 19.22 8975 18103 95.5 96.1 20.7% 0.0% 0.0% 0.0% 3.09sec 1043691 299.78sec
visions visions solar_empowerment 279729 642048 2142 15.67 8198 0 78.3 78.3 0.0% 0.0% 0.0% 0.0% 3.75sec 642048 299.78sec
visions visions starsurge 78674 4502043 15018 12.91 57664 116229 64.8 64.5 20.7% 0.0% 0.0% 0.0% 4.67sec 4502043 299.78sec
visions visions stellar_flare 202347 43788 146 2.56 2846 5675 12.8 12.8 20.4% 0.0% 0.0% 0.0% 23.57sec 594959 299.78sec
visions visions stellar_flare ticks -202347 551172 1837 45.13 2015 4063 12.8 225.7 20.9% 0.0% 0.0% 0.0% 23.57sec 594959 299.78sec
visions visions streaking_stars 272873 2689840 8973 26.75 16568 33109 133.7 133.7 21.5% 0.0% 0.0% 0.0% 2.15sec 2689840 299.78sec
visions visions sunfire 93402 99655 332 3.60 4628 9258 18.0 18.0 19.8% 0.0% 0.0% 0.0% 16.67sec 1018221 299.78sec
visions visions sunfire ticks -93402 918566 3062 45.45 3340 6731 18.0 227.2 20.7% 0.0% 0.0% 0.0% 16.67sec 1018221 299.78sec
worldvein worldvein augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
worldvein worldvein berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.57sec 0 299.78sec
worldvein worldvein celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.70sec 0 299.78sec
worldvein worldvein flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
worldvein worldvein food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
worldvein worldvein heed_my_call 271685 90839 303 1.65 9127 18243 8.2 8.2 20.9% 0.0% 0.0% 0.0% 33.05sec 90839 299.78sec
worldvein worldvein heed_my_call_aoe 271686 38931 130 1.65 3912 7819 8.2 8.2 20.9% 0.0% 0.0% 0.0% 33.05sec 38931 299.78sec
worldvein worldvein lunar_strike 194153 1835721 6123 15.37 19762 40214 76.8 76.8 20.3% 0.0% 0.0% 0.0% 3.80sec 1835721 299.78sec
worldvein worldvein moonfire 8921 58022 194 2.81 3410 6954 14.0 14.0 20.5% 0.0% 0.0% 0.0% 21.36sec 909155 299.78sec
worldvein worldvein moonfire ticks -8921 851133 2837 44.57 3136 6414 14.0 222.8 20.8% 0.0% 0.0% 0.0% 21.36sec 909155 299.78sec
worldvein worldvein moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
worldvein worldvein potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
worldvein worldvein shooting_stars 202497 292539 976 8.90 5391 11030 44.5 44.5 21.0% 0.0% 0.0% 0.0% 6.59sec 292539 299.78sec
worldvein worldvein solar_wrath 190984 1019368 3400 18.58 9021 18448 92.3 92.8 20.8% 0.0% 0.0% 0.0% 3.18sec 1019368 299.78sec
worldvein worldvein solar_empowerment 279729 613663 2047 14.78 8310 0 73.8 73.8 0.0% 0.0% 0.0% 0.0% 3.97sec 613663 299.78sec
worldvein worldvein starsurge 78674 4305892 14363 12.15 57888 118899 60.9 60.7 21.4% 0.0% 0.0% 0.0% 4.95sec 4305892 299.78sec
worldvein worldvein stellar_flare 202347 45043 150 2.55 2856 5858 12.7 12.7 22.6% 0.0% 0.0% 0.0% 23.57sec 590477 299.78sec
worldvein worldvein stellar_flare ticks -202347 545434 1818 44.07 2032 4156 12.7 220.3 20.9% 0.0% 0.0% 0.0% 23.57sec 590477 299.78sec
worldvein worldvein streaking_stars 272873 1828658 6100 17.96 16390 32752 89.7 89.7 24.4% 0.0% 0.0% 0.0% 3.10sec 1828658 299.78sec
worldvein worldvein sunfire 93402 101322 338 3.61 4696 9458 18.0 18.0 19.4% 0.0% 0.0% 0.0% 16.54sec 1012261 299.78sec
worldvein worldvein sunfire ticks -93402 910939 3036 44.39 3368 6891 18.0 222.0 20.9% 0.0% 0.0% 0.0% 16.54sec 1012261 299.78sec
worldvein worldvein worldvein_resonance 295186 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.36sec 0 299.78sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
359814.0 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.8 0.0 0.0sec 0.0sec 13.73% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:13.73%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 8.71% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.71%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.43% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.43%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 9.05% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:9.05%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.48% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.48%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.98% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.98%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 12.40% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:12.40%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.78% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.78%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 6.88% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:6.88%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.58% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.58%

Trigger Attempt Success

  • trigger_pct:100.00%
Blood of the Enemy 2.0 0.0 182.8sec 182.8sec 6.76% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_blood_of_the_enemy
  • max_stacks:1
  • duration:10.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • blood_of_the_enemy_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297108
  • name:Blood of the Enemy
  • tooltip:You have a $w2% increased chance to be Critically Hit by the caster.
  • description:The Heart of Azeroth erupts violently, dealing $s1 Shadow damage to enemies within $A1 yds. You gain $m2% critical strike chance against the targets for {$d=10 seconds}$?a297122[, and increases your critical hit damage by $297126m% for {$297126d=5 seconds}][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 359814.00
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 14412
Mean 299.78
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 14412
Mean 385290.28
Minimum 363326.51
Maximum 413363.82
Spread ( max - min ) 50037.31
Range [ ( max - min ) / 2 * 100% ] 6.49%
Standard Deviation 8002.8265
5th Percentile 372966.10
95th Percentile 398466.05
( 95th Percentile - 5th Percentile ) 25499.95
Mean Distribution
Standard Deviation 66.6625
95.00% Confidence Intervall ( 385159.63 - 385420.94 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1658
0.1 Scale Factor Error with Delta=300 546727
0.05 Scale Factor Error with Delta=300 2186908
0.01 Scale Factor Error with Delta=300 54672694
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 14412
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 2765
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 105647495 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 2700 2700 2700
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

\n\n